SitesBLAST
Comparing GFF2094 FitnessBrowser__Marino:GFF2094 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
51% identity, 93% coverage: 2:319/342 of query aligns to 3:326/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), S35 (= S34), G37 (= G36), D57 (= D50), L58 (= L51), F79 (= F72), A80 (= A73), I83 (= I76), N98 (= N91), Y147 (= Y140), K151 (= K144), Y175 (= Y167), N177 (= N169), V178 (= V170)
2c20A Crystal structure of udp-glucose 4-epimerase
45% identity, 92% coverage: 3:318/342 of query aligns to 3:319/329 of 2c20A
- active site: T117 (= T116), A118 (= A117), A119 (= A118), Y141 (= Y140), K145 (= K144), H184 (≠ T183)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), Q34 (≠ S34), T35 (= T35), G36 (= G36), D51 (= D50), L52 (= L51), F73 (= F72), A74 (= A73), A75 (= A74), N92 (= N91), Y141 (= Y140), K145 (= K144), Y168 (= Y167), F169 (= F168), V171 (= V170), H184 (≠ T183)
- binding zinc ion: E182 (≠ Q181), H184 (≠ T183), E187 (≠ A186), H189 (= H188)
4twrA Structure of udp-glucose 4-epimerase from brucella abortus
45% identity, 92% coverage: 2:315/342 of query aligns to 3:316/325 of 4twrA
- active site: S117 (≠ T116), C118 (≠ A117), A119 (= A118), Y141 (= Y140), K145 (= K144), H184 (≠ T183), H189 (= H188)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (≠ Y11), I13 (= I12), D32 (= D31), N33 (= N32), L34 (= L33), S35 (= S34), T36 (= T35), G37 (= G36), D51 (= D50), I52 (≠ L51), F73 (= F72), A74 (= A73), A75 (= A74), N92 (= N91), S115 (= S114), K145 (= K144), Y168 (= Y167), A171 (≠ V170), H184 (≠ T183)
- binding zinc ion: E182 (≠ Q181), H184 (≠ T183), E187 (≠ A186), H189 (= H188)
1gy8C Trypanosoma brucei udp-galactose 4' epimerase (see paper)
41% identity, 93% coverage: 1:319/342 of query aligns to 3:362/370 of 1gy8C
- active site: S144 (≠ T116), A145 (= A117), A146 (= A118), Y170 (= Y140), K174 (= K144)
- binding nicotinamide-adenine-dinucleotide: G9 (= G7), G12 (= G10), Y13 (= Y11), I14 (= I12), D34 (= D31), S35 (≠ N32), L36 (= L33), V37 (vs. gap), G38 (vs. gap), D77 (= D50), V78 (≠ L51), M100 (≠ F72), C101 (≠ A73), A102 (= A74), L104 (≠ I76), N119 (= N91), S142 (= S114), S143 (= S115), S144 (≠ T116), Y170 (= Y140), K174 (= K144), Y197 (= Y167), A200 (≠ V170)
- binding uridine-5'-diphosphate: N199 (= N169), H218 (= H188), L219 (= L189), I222 (vs. gap), M241 (= M204), P242 (≠ S205), I243 (≠ V206), F244 (= F207), C255 (= C218), R257 (= R220), R324 (= R281), D327 (= D284)
2cnbA Trypanosoma brucei udp-galactose-4-epimerase in ternary complex with NAD and the substrate analogue udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
41% identity, 93% coverage: 1:319/342 of query aligns to 3:358/366 of 2cnbA
- active site: S144 (≠ T116), A145 (= A117), A146 (= A118), Y169 (= Y140), K173 (= K144)
- binding nicotinamide-adenine-dinucleotide: G9 (= G7), G12 (= G10), Y13 (= Y11), I14 (= I12), D34 (= D31), S35 (≠ N32), V37 (vs. gap), G38 (vs. gap), D77 (= D50), V78 (≠ L51), M100 (≠ F72), C101 (≠ A73), A102 (= A74), L104 (≠ I76), N119 (= N91), S143 (= S115), S144 (≠ T116), Y169 (= Y140), K173 (= K144), Y196 (= Y167), F197 (= F168), A199 (≠ V170)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: L104 (≠ I76), S144 (≠ T116), Y169 (= Y140), F197 (= F168), N198 (= N169), H217 (= H188), L218 (= L189), P238 (≠ S205), I239 (≠ V206), F240 (= F207), C251 (= C218), R253 (= R220), V297 (= V258), R320 (= R281), D323 (= D284)
Q9SA77 UDP-arabinose 4-epimerase 1; UDP-D-xylose 4-epimerase 1; EC 5.1.3.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 98% coverage: 3:336/342 of query aligns to 73:419/419 of Q9SA77
- G275 (≠ C194) mutation to D: In mur4-1; 50% reduction in L-Ara in cell wall material.
- R304 (= R220) mutation to Q: In mur4-3; 50% reduction in L-Ara in cell wall material.
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
39% identity, 97% coverage: 2:333/342 of query aligns to 3:343/345 of 1hzjA
- active site: S131 (≠ T116), A132 (= A117), T133 (≠ A118), Y156 (= Y140), K160 (= K144)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), H35 (≠ S34), N36 (≠ T35), D65 (= D50), I66 (≠ L51), F87 (= F72), A88 (= A73), G89 (≠ A74), K91 (≠ I76), S129 (= S114), S131 (≠ T116), Y156 (= Y140), K160 (= K144), Y184 (= Y167), P187 (≠ V170)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N169), N206 (≠ H188), L207 (= L189), N223 (≠ S205), V224 (= V206), F225 (= F207), R238 (= R220), Y240 (= Y222), V276 (= V258), R299 (= R281), D302 (= D284)
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
39% identity, 97% coverage: 2:333/342 of query aligns to 4:344/346 of 1ek6A
- active site: S132 (≠ T116), A133 (= A117), T134 (≠ A118), Y157 (= Y140), K161 (= K144)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G7), G12 (= G10), Y13 (= Y11), I14 (= I12), D33 (= D31), N34 (= N32), H36 (≠ S34), N37 (≠ T35), D66 (= D50), I67 (≠ L51), F88 (= F72), A89 (= A73), G90 (≠ A74), K92 (≠ I76), S130 (= S114), S131 (= S115), S132 (≠ T116), Y157 (= Y140), K161 (= K144), Y185 (= Y167), P188 (≠ V170)
- binding uridine-5'-diphosphate-glucose: S132 (≠ T116), Y157 (= Y140), F186 (= F168), N187 (= N169), N207 (≠ H188), L208 (= L189), N224 (≠ S205), V225 (= V206), F226 (= F207), R239 (= R220), Y241 (= Y222), V277 (= V258), R300 (= R281), D303 (= D284)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
39% identity, 97% coverage: 2:333/342 of query aligns to 4:344/348 of Q14376
- GYI 12:14 (= GYI 10:12) binding
- DNFHN 33:37 (≠ DNLST 31:35) binding
- N34 (= N32) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (≠ DL 50:51) binding
- F88 (= F72) binding
- G90 (≠ A74) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (≠ I76) binding
- V94 (= V78) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ K87) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (≠ T116) mutation to A: Loss of activity.
- SAT 132:134 (≠ TAA 116:118) binding
- Y157 (= Y140) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K144) binding
- A180 (≠ Y162) to V: in dbSNP:rs3204468
- L183 (= L165) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y167) binding
- YFN 185:187 (= YFN 167:169) binding
- NNL 206:208 (≠ THL 187:189) binding
- NVF 224:226 (≠ SVF 205:207) binding
- R239 (= R220) binding
- K257 (≠ Y238) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RAGD 281:284) binding
- C307 (≠ L288) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (= L294) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G300) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (≠ Q323) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
39% identity, 97% coverage: 2:333/342 of query aligns to 3:343/347 of 1i3lA
- active site: S131 (≠ T116), A132 (= A117), T133 (≠ A118), Y156 (= Y140), K160 (= K144)
- binding galactose-uridine-5'-diphosphate: N186 (= N169), N206 (≠ H188), L207 (= L189), N223 (≠ S205), V224 (= V206), F225 (= F207), R238 (= R220), Y240 (= Y222), V276 (= V258), R299 (= R281), D302 (= D284)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), H35 (≠ S34), N36 (≠ T35), D65 (= D50), I66 (≠ L51), F87 (= F72), A88 (= A73), G89 (≠ A74), K91 (≠ I76), S129 (= S114), S130 (= S115), S131 (≠ T116), Y156 (= Y140), K160 (= K144), Y184 (= Y167), P187 (≠ V170)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
39% identity, 97% coverage: 2:333/342 of query aligns to 3:343/347 of 1i3kA
- active site: S131 (≠ T116), A132 (= A117), T133 (≠ A118), Y156 (= Y140), K160 (= K144)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), H35 (≠ S34), N36 (≠ T35), D65 (= D50), I66 (≠ L51), F87 (= F72), A88 (= A73), G89 (≠ A74), K91 (≠ I76), S129 (= S114), S131 (≠ T116), Y156 (= Y140), K160 (= K144), Y184 (= Y167), P187 (≠ V170)
- binding uridine-5'-diphosphate-glucose: F185 (= F168), N186 (= N169), N206 (≠ H188), L207 (= L189), N223 (≠ S205), V224 (= V206), F225 (= F207), R238 (= R220), Y240 (= Y222), V276 (= V258), R299 (= R281), D302 (= D284)
3enkA 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
40% identity, 93% coverage: 3:319/342 of query aligns to 7:332/340 of 3enkA
- active site: S127 (= S115), S128 (≠ T116), T130 (≠ A118), Y152 (= Y140), K156 (= K144)
- binding nicotinamide-adenine-dinucleotide: G11 (= G7), G14 (= G10), Y15 (= Y11), I16 (= I12), D35 (= D31), N36 (= N32), V38 (≠ S34), N39 (≠ T35), S40 (≠ G36), D62 (= D50), V63 (≠ L51), F84 (= F72), A85 (= A73), A86 (= A74), K88 (≠ I76), N103 (= N91), S126 (= S114), S128 (≠ T116), Y152 (= Y140), K156 (= K144), Y180 (= Y167), P183 (≠ V170)
- binding uridine-5'-diphosphate-glucose: T130 (≠ A118), N182 (= N169), N201 (≠ T187), N202 (≠ H188), L203 (= L189), R219 (≠ S205), V220 (= V206), F221 (= F207), R234 (= R220), Y236 (= Y222), V272 (= V258), R295 (= R281), D298 (= D284)
Q564Q1 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Caenorhabditis elegans (see paper)
38% identity, 98% coverage: 1:334/342 of query aligns to 1:348/349 of Q564Q1
- P314 (≠ N292) mutation to L: In pv18; at the restrictive temperature of 25 degrees Celsius, embryos have cell-cell adhesion defects and die before hatching. The few surviving animals are arrested at the L1 larval stage. At the permissive temperature of 16-20 degrees Celsius, causes a developmental delay. Distal tip cell migration is impaired due to a reduced localization of metalloprotease mig-17 to the gonad basement membrane. Vulva lumen is smaller at the L4 larval stage. Accumulation of UDP-galactose (Gal) and reduction in UDP-N-acetylgalactosamine (GalNAc) levels. Hypersensitivity to a galactose-rich diet characterized by a slow development often resulting in an arrest at the L1 larval stage. Up-regulation of ER stress response protein hsp-4; expression is suppressed in an xbp-1 RNAi-mediated knockdown animals. Reduced survival upon E.faecalis or S.aureus-mediated infection.
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
39% identity, 89% coverage: 3:305/342 of query aligns to 4:322/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), N36 (≠ T35), D62 (= D50), L63 (= L51), F84 (= F72), A85 (= A73), G86 (≠ A74), K88 (≠ I76), N103 (= N91), S126 (= S114), S128 (≠ T116), Y152 (= Y140), K156 (= K144), Y180 (= Y167), P183 (≠ V170)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N169), N202 (≠ H188), L203 (= L189), T219 (≠ S205), Y221 (≠ F207), R234 (= R220), Y236 (= Y222), V275 (= V258), R298 (= R281), D301 (= D284)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
39% identity, 89% coverage: 3:305/342 of query aligns to 4:322/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), N36 (≠ T35), D62 (= D50), L63 (= L51), F84 (= F72), A85 (= A73), G86 (≠ A74), K88 (≠ I76), N103 (= N91), S126 (= S114), S128 (≠ T116), Y152 (= Y140), K156 (= K144), Y180 (= Y167), P183 (≠ V170)
- binding uridine-5'-diphosphate-glucose: S128 (≠ T116), A129 (= A117), F181 (= F168), N182 (= N169), N202 (≠ H188), L203 (= L189), T219 (≠ S205), V220 (= V206), Y221 (≠ F207), R234 (= R220), Y236 (= Y222), V275 (= V258), R298 (= R281), D301 (= D284)
7kn1A Crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound NAD and formylated udp- arabinopyranose
39% identity, 95% coverage: 1:324/342 of query aligns to 3:331/336 of 7kn1A
- active site: S126 (≠ T116), Y150 (= Y140), K154 (= K144)
- binding nicotinamide-adenine-dinucleotide: G9 (= G7), G12 (= G10), Y13 (= Y11), I14 (= I12), D33 (= D31), S34 (≠ N32), C36 (≠ S34), N37 (≠ T35), D60 (= D50), I61 (≠ L51), F82 (= F72), A83 (= A73), A84 (= A74), K86 (≠ I76), S124 (= S114), S125 (= S115), S126 (≠ T116), Y150 (= Y140), K154 (= K144), Y178 (= Y167), P181 (≠ V170)
- binding UDP-4-deoxy-4-formamido-beta-L-arabinopyranose: V88 (= V78), S126 (≠ T116), Y150 (= Y140), N180 (= N169), S199 (≠ E185), N200 (vs. gap), L201 (vs. gap), Q217 (≠ S205), V218 (= V206), F219 (= F207), R232 (= R220), Y234 (= Y222), V270 (= V258), R293 (= R281), D296 (= D284)
6k0iA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glc (see paper)
40% identity, 93% coverage: 3:319/342 of query aligns to 3:328/335 of 6k0iA
- active site: S124 (≠ T116), A125 (= A117), T126 (≠ A118), Y149 (= Y140), K153 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (≠ Y11), I12 (= I12), D31 (= D31), N32 (= N32), N35 (≠ T35), S36 (≠ G36), D58 (= D50), V59 (≠ L51), F80 (= F72), A81 (= A73), G82 (≠ A74), K84 (≠ I76), N99 (= N91), S122 (= S114), S123 (= S115), Y149 (= Y140), K153 (= K144), Y177 (= Y167), P180 (≠ V170)
- binding uridine-5'-diphosphate-glucose: K84 (≠ I76), S124 (≠ T116), Y149 (= Y140), F178 (= F168), N179 (= N169), A198 (= A186), N199 (≠ T187), L200 (≠ H188), Q216 (≠ S205), V217 (= V206), Y218 (≠ F207), R231 (= R220), Y233 (= Y222), V268 (= V258), R291 (= R281), D294 (= D284)
6k0hA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glcnac (see paper)
40% identity, 93% coverage: 3:319/342 of query aligns to 3:328/335 of 6k0hA
- active site: S124 (≠ T116), A125 (= A117), T126 (≠ A118), Y149 (= Y140), K153 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (≠ Y11), I12 (= I12), D31 (= D31), N32 (= N32), G34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D50), V59 (≠ L51), F80 (= F72), A81 (= A73), G82 (≠ A74), K84 (≠ I76), N99 (= N91), S123 (= S115), Y149 (= Y140), K153 (= K144), Y177 (= Y167), P180 (≠ V170)
- binding uridine-diphosphate-n-acetylglucosamine: K84 (≠ I76), S124 (≠ T116), Y149 (= Y140), F178 (= F168), N179 (= N169), A198 (= A186), N199 (≠ T187), L200 (≠ H188), Q216 (≠ S205), V217 (= V206), Y218 (≠ F207), R231 (= R220), Y233 (= Y222), V268 (= V258), R291 (= R281), D294 (= D284)
6k0gA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp (see paper)
40% identity, 93% coverage: 3:319/342 of query aligns to 3:328/335 of 6k0gA
- active site: S124 (≠ T116), A125 (= A117), T126 (≠ A118), Y149 (= Y140), K153 (= K144)
- binding magnesium ion: E66 (= E58), H114 (= H106)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (≠ Y11), I12 (= I12), D31 (= D31), N32 (= N32), N35 (≠ T35), S36 (≠ G36), D58 (= D50), V59 (≠ L51), F80 (= F72), A81 (= A73), G82 (≠ A74), K84 (≠ I76), N99 (= N91), S122 (= S114), S123 (= S115), Y149 (= Y140), K153 (= K144), Y177 (= Y167), P180 (≠ V170)
- binding uridine-5'-diphosphate: N179 (= N169), A198 (= A186), N199 (≠ T187), L200 (≠ H188), Q216 (≠ S205), V217 (= V206), Y218 (≠ F207), R231 (= R220), Y233 (= Y222), V268 (= V258), R291 (= R281), D294 (= D284)
4lisB Crystal structure of udp-galactose-4-epimerase from aspergillus nidulans (see paper)
40% identity, 88% coverage: 3:302/342 of query aligns to 4:332/363 of 4lisB
- active site: S126 (≠ T116), A127 (= A117), T128 (≠ A118), Y154 (= Y140), K158 (= K144)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), N36 (≠ T35), S37 (≠ G36), D59 (= D50), V60 (≠ L51), F82 (= F72), A84 (= A74), K86 (≠ I76), S126 (≠ T116), Y154 (= Y140), K158 (= K144), Y195 (= Y167), P198 (≠ V170)
- binding uridine-5'-diphosphate: N197 (= N169), N217 (≠ H188), L218 (= L189), L234 (≠ S205), V235 (= V206), F236 (= F207), R249 (= R220), V288 (= V258), R311 (= R281), D314 (= D284)
Query Sequence
>GFF2094 FitnessBrowser__Marino:GFF2094
MKVLVTGGAGYIGSHVVRQLGQAGHDIVVFDNLSTGYRWAVTAGELVVGDLADEAAIEDL
FSRHQFEAVLHFAANIVVPESVANPLKYYSNNTRNTLNLLKAVEKHEVPYMVFSSTAAVY
GMPEQTVLTEDLPLAPINPYGASKMMSERMIMDLAAASSLNYVILRYFNVAGANPEGLLG
QATPEATHLIKVACECVTEQREGMSVFGTDYDTRDGTCIRDYIHVEDLAKAHVMALDYMA
DGGHSKVMNCGYGRGFTVREVIDVVKAQSGVDFPVTETGRRAGDPAALMADNTLIRQTLG
WQPDYDNLDTIVGTALAWEAIWQKKKLTTPHNFSVFVSGFNG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory