SitesBLAST
Comparing GFF2094 PS417_10680 enoyl-CoA hydratase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
40% identity, 98% coverage: 7:263/263 of query aligns to 5:257/257 of 6slbAAA
- active site: Q64 (≠ A66), F69 (≠ W71), L80 (= L80), N84 (≠ G84), A108 (= A114), S111 (≠ D117), A130 (≠ G136), F131 (≠ Y137), L136 (≠ Y142), P138 (= P144), D139 (= D145), A224 (≠ Q230), G234 (= G240)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (= R60), A62 (= A64), Q64 (≠ A66), D65 (= D67), L66 (= L68), Y76 (≠ A76), A108 (= A114), F131 (≠ Y137), D139 (= D145)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
40% identity, 98% coverage: 7:263/263 of query aligns to 2:245/245 of 6slaAAA
- active site: Q61 (≠ A66), L68 (= L80), N72 (≠ G84), A96 (= A114), S99 (≠ D117), A118 (≠ G136), F119 (≠ Y137), L124 (≠ Y142), P126 (= P144), N127 (≠ D145), A212 (≠ Q230), G222 (= G240)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ R26), A59 (= A64), Q61 (≠ A66), D62 (= D67), L63 (= L68), L68 (= L80), Y71 (= Y83), A94 (≠ V112), G95 (= G113), A96 (= A114), F119 (≠ Y137), I122 (≠ M140), L124 (≠ Y142), N127 (≠ D145), F234 (≠ S252), K237 (= K255)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
32% identity, 98% coverage: 7:263/263 of query aligns to 6:259/259 of 5zaiC
- active site: A65 (= A66), F70 (≠ W71), S82 (≠ T86), R86 (≠ H90), G110 (≠ A114), E113 (≠ D117), P132 (≠ G136), E133 (≠ Y137), I138 (≠ Y142), P140 (= P144), G141 (≠ D145), A226 (≠ Q230), F236 (≠ G240)
- binding coenzyme a: K24 (≠ Q25), L25 (≠ R26), A63 (= A64), G64 (= G65), A65 (= A66), D66 (= D67), I67 (≠ L68), P132 (≠ G136), R166 (≠ L170), F248 (≠ S252), K251 (= K255)
Q9P4U9 Enoyl-CoA hydratase AKT3-1; AF-toxin biosynthesis protein 3-1; EC 4.2.1.17 from Alternaria alternata (Alternaria rot fungus) (Torula alternata) (see paper)
36% identity, 94% coverage: 14:260/263 of query aligns to 24:268/296 of Q9P4U9
Sites not aligning to the query:
- 294:296 Peroxisomal targeting signal type 1
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
34% identity, 93% coverage: 19:263/263 of query aligns to 19:261/261 of 5jbxB
- active site: A67 (= A66), R72 (≠ W71), L84 (≠ T86), R88 (≠ H90), G112 (≠ A114), E115 (≠ D117), T134 (≠ G136), E135 (≠ Y137), I140 (≠ Y142), P142 (= P144), G143 (≠ D145), A228 (≠ Q230), L238 (≠ G240)
- binding coenzyme a: S24 (≠ P24), R25 (≠ Q25), R26 (= R26), A28 (= A28), A65 (= A64), D68 (= D67), L69 (= L68), K70 (≠ A69), L110 (≠ V112), G111 (= G113), T134 (≠ G136), E135 (≠ Y137), L138 (≠ M140), R168 (≠ L170)
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
33% identity, 92% coverage: 18:258/263 of query aligns to 24:263/270 of Q4WF54
Sites not aligning to the query:
- 268:270 PTS1-type peroxisomal targeting signal
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
31% identity, 95% coverage: 13:261/263 of query aligns to 13:256/258 of 1ey3A
- active site: A66 (= A66), M71 (≠ W71), S81 (≠ G84), L85 (≠ T88), G109 (≠ A114), E112 (≠ D117), P131 (≠ G136), E132 (≠ Y137), T137 (≠ Y142), P139 (= P144), G140 (≠ D145), K225 (≠ Q230), F235 (≠ G240)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ P24), L26 (≠ R26), A28 (= A28), A64 (= A64), G65 (= G65), A66 (= A66), D67 (= D67), I68 (≠ L68), L85 (≠ T88), W88 (vs. gap), G109 (≠ A114), P131 (≠ G136), L135 (≠ M140), G140 (≠ D145)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
30% identity, 95% coverage: 12:261/263 of query aligns to 44:288/290 of P14604
- E144 (≠ D117) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ Y137) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
31% identity, 95% coverage: 13:261/263 of query aligns to 15:258/260 of 1dubA
- active site: A68 (= A66), M73 (≠ W71), S83 (≠ G84), L87 (≠ T88), G111 (≠ A114), E114 (≠ D117), P133 (≠ G136), E134 (≠ Y137), T139 (≠ Y142), P141 (= P144), G142 (≠ D145), K227 (≠ Q230), F237 (≠ G240)
- binding acetoacetyl-coenzyme a: K26 (≠ P24), A27 (≠ Q25), L28 (≠ R26), A30 (= A28), A66 (= A64), A68 (= A66), D69 (= D67), I70 (≠ L68), Y107 (≠ T110), G110 (= G113), G111 (≠ A114), E114 (≠ D117), P133 (≠ G136), E134 (≠ Y137), L137 (≠ M140), G142 (≠ D145), F233 (≠ G236), F249 (≠ S252)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
30% identity, 97% coverage: 7:261/263 of query aligns to 5:254/256 of 3h81A
- active site: A64 (= A66), M69 (≠ W71), T79 (= T88), F83 (≠ L92), G107 (≠ A114), E110 (≠ D117), P129 (≠ G136), E130 (≠ Y137), V135 (≠ Y142), P137 (= P144), G138 (≠ D145), L223 (≠ Q230), F233 (≠ G240)
- binding calcium ion: F233 (≠ G240), Q238 (≠ G245)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
30% identity, 99% coverage: 1:261/263 of query aligns to 1:255/255 of 3q0jC
- active site: A65 (= A66), M70 (≠ W71), T80 (= T88), F84 (≠ L92), G108 (≠ A114), E111 (≠ D117), P130 (≠ G136), E131 (≠ Y137), V136 (≠ Y142), P138 (= P144), G139 (≠ D145), L224 (≠ Q230), F234 (≠ G240)
- binding acetoacetyl-coenzyme a: Q23 (≠ P24), A24 (≠ Q25), L25 (≠ R26), A27 (= A28), A63 (= A64), G64 (= G65), A65 (= A66), D66 (= D67), I67 (≠ L68), K68 (≠ A69), M70 (≠ W71), F84 (≠ L92), G107 (= G113), G108 (≠ A114), E111 (≠ D117), P130 (≠ G136), E131 (≠ Y137), P138 (= P144), G139 (≠ D145), M140 (≠ A146)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
30% identity, 99% coverage: 1:261/263 of query aligns to 1:255/255 of 3q0gC
- active site: A65 (= A66), M70 (≠ W71), T80 (= T88), F84 (≠ L92), G108 (≠ A114), E111 (≠ D117), P130 (≠ G136), E131 (≠ Y137), V136 (≠ Y142), P138 (= P144), G139 (≠ D145), L224 (≠ Q230), F234 (≠ G240)
- binding coenzyme a: L25 (≠ R26), A63 (= A64), I67 (≠ L68), K68 (≠ A69), Y104 (≠ T110), P130 (≠ G136), E131 (≠ Y137), L134 (≠ M140)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
31% identity, 95% coverage: 13:261/263 of query aligns to 14:252/254 of 2dubA
- active site: A67 (= A66), M72 (≠ W71), S82 (≠ G84), G105 (≠ A114), E108 (≠ D117), P127 (≠ G136), E128 (≠ Y137), T133 (≠ Y142), P135 (= P144), G136 (≠ D145), K221 (≠ Q230), F231 (≠ G240)
- binding octanoyl-coenzyme a: K25 (≠ P24), A26 (≠ Q25), L27 (≠ R26), A29 (= A28), A65 (= A64), A67 (= A66), D68 (= D67), I69 (≠ L68), K70 (≠ A69), G105 (≠ A114), E108 (≠ D117), P127 (≠ G136), E128 (≠ Y137), G136 (≠ D145), A137 (= A146)
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
31% identity, 95% coverage: 13:261/263 of query aligns to 15:256/258 of 1mj3A
- active site: A68 (= A66), M73 (≠ W71), S83 (vs. gap), L85 (≠ W85), G109 (≠ A114), E112 (≠ D117), P131 (≠ G136), E132 (≠ Y137), T137 (≠ Y142), P139 (= P144), G140 (≠ D145), K225 (≠ Q230), F235 (≠ G240)
- binding hexanoyl-coenzyme a: K26 (≠ P24), A27 (≠ Q25), L28 (≠ R26), A30 (= A28), A66 (= A64), G67 (= G65), A68 (= A66), D69 (= D67), I70 (≠ L68), G109 (≠ A114), P131 (≠ G136), E132 (≠ Y137), L135 (≠ M140), G140 (≠ D145)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
30% identity, 97% coverage: 7:261/263 of query aligns to 5:250/250 of 3q0gD
- active site: A64 (= A66), M69 (≠ W71), T75 (= T86), F79 (≠ H90), G103 (≠ A114), E106 (≠ D117), P125 (≠ G136), E126 (≠ Y137), V131 (≠ Y142), P133 (= P144), G134 (≠ D145), L219 (≠ Q230), F229 (≠ G240)
- binding Butyryl Coenzyme A: F225 (≠ G236), F241 (≠ S252)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
29% identity, 94% coverage: 15:261/263 of query aligns to 17:258/260 of 2hw5C
- active site: A68 (= A66), M73 (≠ L80), S83 (≠ H90), L87 (≠ T94), G111 (≠ A114), E114 (≠ D117), P133 (≠ G136), E134 (≠ Y137), T139 (≠ Y142), P141 (= P144), G142 (≠ D145), K227 (≠ Q228), F237 (≠ L238)
- binding crotonyl coenzyme a: K26 (≠ P24), A27 (≠ Q25), L28 (≠ R26), A30 (= A28), K62 (≠ R60), I70 (≠ L68), F109 (≠ V112)
Q13825 Methylglutaconyl-CoA hydratase, mitochondrial; 3-MG-CoA hydratase; AU-specific RNA-binding enoyl-CoA hydratase; AU-binding protein/enoyl-CoA hydratase; Itaconyl-CoA hydratase; EC 4.2.1.18; EC 4.2.1.56 from Homo sapiens (Human) (see 4 papers)
33% identity, 97% coverage: 8:263/263 of query aligns to 82:339/339 of Q13825
- K105 (≠ I31) mutation to N: Abolishes RNA-binding; when associated with E-109 and Q-113.
- 105:119 (vs. 31:45, 20% identical) RNA-binding
- K109 (= K35) mutation to E: Abolishes RNA-binding; when associated with N-105 and Q-113.
- K113 (≠ A39) mutation to Q: Abolishes RNA-binding; when associated with N-105 and E-109.
- A240 (≠ D168) to V: in MGCA1; decreased methylglutaconyl-CoA hydratase activity; dbSNP:rs769894315
Sites not aligning to the query:
- 1:67 modified: transit peptide, Mitochondrion
3p85A Crystal structure enoyl-coa hydratase from mycobacterium avium (see paper)
35% identity, 75% coverage: 7:202/263 of query aligns to 3:180/224 of 3p85A
- active site: L62 (≠ A66), L67 (≠ W71), P68 (≠ A72), G92 (≠ A114), E95 (≠ D117), T114 (≠ G136), H115 (≠ Y137), L120 (≠ Y142), P122 (= P144), T123 (≠ D145)
- binding calcium ion: D43 (= D47), D45 (≠ A49)
Sites not aligning to the query:
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
30% identity, 94% coverage: 18:263/263 of query aligns to 21:266/266 of O53561
- K135 (≠ R132) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 132:139, 13% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ S139) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
Q9LKJ1 3-hydroxyisobutyryl-CoA hydrolase 1; CoA-thioester hydrolase CHY1; EC 3.1.2.-; EC 3.1.2.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 86% coverage: 1:225/263 of query aligns to 5:235/378 of Q9LKJ1
- G70 (≠ A66) mutation to S: Loss of activity.
- E142 (≠ Y137) mutation to A: Loss of activity.
- D150 (= D145) mutation to G: Reduced activity.
Query Sequence
>GFF2094 PS417_10680 enoyl-CoA hydratase
MTIDSPVLTQVQAGVAWITLNRGPQRNALDIPTLKHLHALLDTFNTDPAVRVVVLTGNGR
SFCAGADLAEWAAAEARGALETYGWTDTAHALMTRLHTLDKPTIAAINGTAVGAGMDLTL
CCDLRVAAQSARFKAGYTSMAYSPDAGASWHLPRLIGSEQAKRLLFLDELWSADRALAAG
LVGEVVTDDHLHAHTNALATRLANGPTFAFAQTKTLIRDGAERSLPAQLQAELAAGLLCG
RSADGTEALRASLEKRLPIFSGK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory