SitesBLAST
Comparing GFF2097 FitnessBrowser__WCS417:GFF2097 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
32% identity, 99% coverage: 4:530/535 of query aligns to 4:518/539 of 6lpiB
- active site: I27 (= I27), G29 (= G29), G30 (≠ V30), S31 (≠ H31), I32 (≠ T32), E53 (= E52), C76 (≠ I75), F115 (≠ H117), Q116 (≠ E118), E117 (≠ T119), K165 (≠ L167), M256 (≠ T256), A283 (vs. gap), V375 (≠ M383), G401 (= G409), M403 (≠ L411), D428 (= D436), N455 (= N464), A457 (= A466), L458 (= L467), L460 (≠ Q469), V461 (≠ I470), Q464 (≠ R471)
- binding flavin-adenine dinucleotide: R155 (= R157), G212 (= G214), G213 (= G215), G214 (= G216), T236 (≠ S238), L237 (≠ V239), M238 (≠ A240), L254 (vs. gap), M256 (≠ T256), H257 (≠ L257), G276 (= G276), A277 (≠ T277), R278 (≠ E278), D280 (≠ A280), R282 (vs. gap), A283 (vs. gap), D300 (= D299), I301 (= I300), D319 (= D318), V320 (≠ A319), M380 (≠ Y388), G398 (≠ T406)
- binding magnesium ion: D428 (= D436), N455 (= N464)
- binding thiamine diphosphate: E53 (= E52), C76 (≠ I75), P79 (= P78), G376 (≠ T384), Q377 (= Q385), H378 (≠ L386), G401 (= G409), M403 (≠ L411), G427 (= G435), D428 (= D436), G429 (= G437), S430 (≠ G438), M433 (≠ Y441), N455 (= N464), A457 (= A466), L458 (= L467), G459 (= G468), L460 (≠ Q469), V461 (≠ I470)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
30% identity, 99% coverage: 3:529/535 of query aligns to 88:633/664 of P09114
- P191 (≠ S105) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ I470) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
30% identity, 99% coverage: 3:529/535 of query aligns to 91:636/667 of P09342
- C161 (= C72) modified: Disulfide link with 307
- P194 (≠ S105) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ A217) modified: Disulfide link with 161
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 8:485/582 of 3ea4A
- active site: Y32 (≠ I27), G34 (= G29), G35 (≠ V30), A36 (≠ H31), S37 (≠ T32), E58 (= E52), T81 (≠ I75), F120 (≠ L116), Q121 (≠ H117), E122 (= E118), K170 (≠ L167), M265 (≠ S255), V292 (≠ T282), V399 (≠ M383), G425 (= G409), M427 (≠ L411), D452 (= D436), N479 (= N464), H481 (≠ A466), L482 (= L467), M484 (≠ Q469), V485 (≠ I470)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D281), R291 (vs. gap)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R157), G221 (= G214), G222 (= G215), G223 (= G216), T245 (≠ S238), L246 (≠ V239), M247 (≠ A240), L263 (≠ A253), G264 (= G254), M265 (≠ S255), H266 (≠ T256), G285 (= G276), R287 (≠ E278), D289 (≠ A280), R291 (vs. gap), D309 (= D299), I310 (= I300), G327 (= G317), D328 (= D318), V329 (≠ A319), M404 (≠ Y388), G422 (≠ T406)
- binding magnesium ion: D452 (= D436), N479 (= N464), H481 (≠ A466)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (≠ M383), G400 (≠ T384), Q401 (= Q385), H402 (≠ L386), M427 (≠ L411), G451 (= G435), D452 (= D436), G453 (= G437), S454 (≠ G438), N479 (= N464), H481 (≠ A466), L482 (= L467), G483 (= G468), M484 (≠ Q469), V485 (≠ I470)
Sites not aligning to the query:
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 8:485/582 of 3e9yA
- active site: Y32 (≠ I27), G34 (= G29), G35 (≠ V30), A36 (≠ H31), S37 (≠ T32), E58 (= E52), T81 (≠ I75), F120 (≠ L116), Q121 (≠ H117), E122 (= E118), K170 (≠ L167), M265 (≠ S255), V292 (≠ T282), V399 (≠ M383), G425 (= G409), M427 (≠ L411), D452 (= D436), N479 (= N464), H481 (≠ A466), L482 (= L467), M484 (≠ Q469), V485 (≠ I470)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D281), R291 (vs. gap)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R157), G221 (= G214), G222 (= G215), G223 (= G216), T245 (≠ S238), L246 (≠ V239), M247 (≠ A240), L263 (≠ A253), G285 (= G276), R287 (≠ E278), D289 (≠ A280), R291 (vs. gap), D309 (= D299), I310 (= I300), G327 (= G317), D328 (= D318), V329 (≠ A319), M404 (≠ Y388), G422 (≠ T406)
- binding magnesium ion: D452 (= D436), N479 (= N464), H481 (≠ A466)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (≠ M383), G400 (≠ T384), Q401 (= Q385), H402 (≠ L386), M427 (≠ L411), G451 (= G435), G453 (= G437), S454 (≠ G438), N479 (= N464), H481 (≠ A466), L482 (= L467), G483 (= G468), M484 (≠ Q469), V485 (≠ I470)
Sites not aligning to the query:
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 9:486/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ S255), R292 (vs. gap)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ M383), G401 (≠ T384), Q402 (= Q385), H403 (≠ L386), G426 (= G409), M428 (≠ L411), G452 (= G435), D453 (= D436), G454 (= G437), S455 (≠ G438), L483 (= L467), G484 (= G468), M485 (≠ Q469), V486 (≠ I470)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G214), G223 (= G215), G224 (= G216), T246 (≠ S238), L247 (≠ V239), M248 (≠ A240), M263 (vs. gap), L264 (≠ A253), M266 (≠ S255), H267 (≠ T256), G286 (= G276), R288 (≠ E278), V293 (≠ T282), D310 (= D299), I311 (= I300), D329 (= D318), V330 (≠ A319), M405 (≠ Y388), G423 (≠ T406)
- binding magnesium ion: A37 (≠ H31), T82 (≠ I75), S83 (≠ T76), Q122 (≠ H117), Y381 (vs. gap), D453 (= D436), M458 (≠ Y441), Q461 (= Q444), N480 (= N464), H482 (≠ A466)
Sites not aligning to the query:
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 9:486/583 of 5k3sA
- active site: Y33 (≠ I27), G35 (= G29), G36 (≠ V30), A37 (≠ H31), S38 (≠ T32), E59 (= E52), T82 (≠ I75), F121 (≠ L116), Q122 (≠ H117), E123 (= E118), K171 (≠ L167), M266 (≠ S255), V293 (≠ T282), V400 (≠ M383), G426 (= G409), M428 (≠ L411), D453 (= D436), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ Q469), V486 (≠ I470)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (vs. gap), M485 (≠ Q469)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G214), G223 (= G215), G224 (= G216), T246 (≠ S238), L247 (≠ V239), M248 (≠ A240), L264 (≠ A253), M266 (≠ S255), G286 (= G276), R288 (≠ E278), D290 (≠ A280), V293 (≠ T282), D310 (= D299), I311 (= I300), D329 (= D318), V330 (≠ A319), M405 (≠ Y388), G423 (≠ T406)
- binding magnesium ion: D453 (= D436), N480 (= N464), H482 (≠ A466)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ M383), G401 (≠ T384), Q402 (= Q385), H403 (≠ L386), G426 (= G409), M428 (≠ L411), D453 (= D436), G454 (= G437), S455 (≠ G438), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468), M485 (≠ Q469), V486 (≠ I470)
Sites not aligning to the query:
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 9:486/585 of 5k2oA
- active site: Y33 (≠ I27), G35 (= G29), G36 (≠ V30), A37 (≠ H31), S38 (≠ T32), E59 (= E52), T82 (≠ I75), F121 (≠ L116), Q122 (≠ H117), E123 (= E118), K171 (≠ L167), M266 (≠ S255), V293 (≠ T282), V400 (≠ M383), G426 (= G409), M428 (≠ L411), D453 (= D436), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ Q469), V486 (≠ I470)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (≠ S255), R292 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G214), G223 (= G215), G224 (= G216), T246 (≠ S238), L247 (≠ V239), M248 (≠ A240), L264 (≠ A253), G286 (= G276), R288 (≠ E278), D290 (≠ A280), V293 (≠ T282), D310 (= D299), I311 (= I300), D329 (= D318), V330 (≠ A319), Q404 (≠ A387), M405 (≠ Y388), G423 (≠ T406)
- binding magnesium ion: D453 (= D436), N480 (= N464), H482 (≠ A466)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ M383), G401 (≠ T384), Q402 (= Q385), H403 (≠ L386), M428 (≠ L411), D453 (= D436), G454 (= G437), S455 (≠ G438), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468), M485 (≠ Q469), V486 (≠ I470)
Sites not aligning to the query:
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
30% identity, 87% coverage: 3:470/535 of query aligns to 94:571/670 of P17597
- A122 (≠ H31) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L33) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E52) binding
- S186 (= S94) binding
- P197 (≠ S105) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ V107) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (≠ H117) binding
- K220 (≠ A131) binding
- R246 (= R157) binding ; binding
- K256 (≠ L167) binding
- G308 (= G215) binding
- TL 331:332 (≠ SV 238:239) binding
- C340 (≠ V247) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ AGST 253:256) binding
- GVRFD 371:375 (≠ GTEMA 276:280) binding
- DR 376:377 (≠ D- 281) binding
- DI 395:396 (= DI 299:300) binding
- DV 414:415 (≠ DA 318:319) binding
- QH 487:488 (≠ QL 385:386) binding
- GG 508:509 (≠ TG 406:407) binding
- GAM 511:513 (≠ GTL 409:411) binding
- D538 (= D436) binding
- DGS 538:540 (≠ DGG 436:438) binding
- N565 (= N464) binding
- NQHLGM 565:570 (≠ NDALGQ 464:469) binding
- H567 (≠ A466) binding
Sites not aligning to the query:
- 574 binding ; W→L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; W→S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- 653 binding ; S→A: No effect on catalytic activity or sensitivity to herbicides.; S→F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; S→N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; S→T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 9:486/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ M383), G401 (≠ T384), Q402 (= Q385), H403 (≠ L386), G426 (= G409), M428 (≠ L411), G452 (= G435), D453 (= D436), G454 (= G437), S455 (≠ G438), M458 (≠ Y441), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468), M485 (≠ Q469), V486 (≠ I470)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G214), G223 (= G215), G224 (= G216), T246 (≠ S238), L247 (≠ V239), M248 (≠ A240), L264 (≠ A253), M266 (≠ S255), H267 (≠ T256), G286 (= G276), V287 (≠ T277), R288 (≠ E278), D290 (≠ A280), R292 (vs. gap), V293 (≠ T282), D310 (= D299), I311 (= I300), D329 (= D318), V330 (≠ A319), M405 (≠ Y388), G423 (≠ T406)
- binding magnesium ion: F370 (vs. gap), D453 (= D436), M458 (≠ Y441), Q461 (= Q444), N480 (= N464), H482 (≠ A466)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ S255), R292 (vs. gap), M485 (≠ Q469)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 9:486/582 of 5wj1A
- active site: Y33 (≠ I27), G35 (= G29), G36 (≠ V30), A37 (≠ H31), S38 (≠ T32), E59 (= E52), T82 (≠ I75), F121 (≠ L116), Q122 (≠ H117), E123 (= E118), K171 (≠ L167), M266 (≠ S255), V293 (≠ T282), V400 (≠ M383), G426 (= G409), M428 (≠ L411), D453 (= D436), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ Q469), V486 (≠ I470)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G214), G223 (= G215), G224 (= G216), T246 (≠ S238), L247 (≠ V239), M248 (≠ A240), M263 (vs. gap), L264 (≠ A253), G286 (= G276), R288 (≠ E278), V293 (≠ T282), D310 (= D299), I311 (= I300), D329 (= D318), V330 (≠ A319), M405 (≠ Y388), G423 (≠ T406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N464), H482 (≠ A466)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ S255), D291 (= D281), R292 (vs. gap), M485 (≠ Q469)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ M383), G401 (≠ T384), Q402 (= Q385), H403 (≠ L386), M428 (≠ L411), D453 (= D436), G454 (= G437), S455 (≠ G438), M458 (≠ Y441), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468), M485 (≠ Q469), V486 (≠ I470)
Sites not aligning to the query:
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 9:486/582 of 5k6tA
- active site: Y33 (≠ I27), G35 (= G29), G36 (≠ V30), A37 (≠ H31), S38 (≠ T32), E59 (= E52), T82 (≠ I75), F121 (≠ L116), Q122 (≠ H117), E123 (= E118), K171 (≠ L167), M266 (≠ S255), V293 (≠ T282), V400 (≠ M383), G426 (= G409), M428 (≠ L411), D453 (= D436), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ Q469), V486 (≠ I470)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ T256), R292 (vs. gap), M485 (≠ Q469)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G214), G223 (= G215), G224 (= G216), T246 (≠ S238), L247 (≠ V239), M248 (≠ A240), L264 (≠ A253), G286 (= G276), R288 (≠ E278), D290 (≠ A280), R292 (vs. gap), V293 (≠ T282), D310 (= D299), I311 (= I300), D329 (= D318), V330 (≠ A319), Q404 (≠ A387), M405 (≠ Y388), G423 (≠ T406)
- binding magnesium ion: D453 (= D436), N480 (= N464), H482 (≠ A466)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ M383), G401 (≠ T384), Q402 (= Q385), H403 (≠ L386), G426 (= G409), M428 (≠ L411), G452 (= G435), G454 (= G437), S455 (≠ G438), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468)
Sites not aligning to the query:
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 9:486/582 of 5k6rA
- active site: Y33 (≠ I27), G35 (= G29), G36 (≠ V30), A37 (≠ H31), S38 (≠ T32), E59 (= E52), T82 (≠ I75), F121 (≠ L116), Q122 (≠ H117), E123 (= E118), K171 (≠ L167), M266 (≠ S255), V293 (≠ T282), V400 (≠ M383), G426 (= G409), M428 (≠ L411), D453 (= D436), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ Q469), V486 (≠ I470)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G214), G223 (= G215), G224 (= G216), T246 (≠ S238), L247 (≠ V239), M248 (≠ A240), L264 (≠ A253), M266 (≠ S255), G286 (= G276), R288 (≠ E278), R292 (vs. gap), V293 (≠ T282), D310 (= D299), I311 (= I300), G328 (= G317), D329 (= D318), V330 (≠ A319), M405 (≠ Y388), G423 (≠ T406)
- binding magnesium ion: D453 (= D436), N480 (= N464), H482 (≠ A466)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ M383), G401 (≠ T384), Q402 (= Q385), H403 (≠ L386), G426 (= G409), M428 (≠ L411), D453 (= D436), G454 (= G437), S455 (≠ G438), M458 (≠ Y441), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468), M485 (≠ Q469), V486 (≠ I470)
Sites not aligning to the query:
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 9:486/582 of 1z8nA
- active site: Y33 (≠ I27), G35 (= G29), G36 (≠ V30), A37 (≠ H31), S38 (≠ T32), E59 (= E52), T82 (≠ I75), F121 (≠ L116), Q122 (≠ H117), E123 (= E118), K171 (≠ L167), M266 (≠ S255), V293 (≠ T282), V400 (≠ M383), G426 (= G409), M428 (≠ L411), D453 (= D436), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ Q469), V486 (≠ I470)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (≠ A131), R161 (= R157), Y191 (vs. gap), R194 (= R184), D291 (= D281), R292 (vs. gap), D312 (= D301)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G214), G224 (= G216), T246 (≠ S238), L247 (≠ V239), M248 (≠ A240), L264 (≠ A253), G265 (= G254), M266 (≠ S255), H267 (≠ T256), G286 (= G276), V287 (≠ T277), R288 (≠ E278), D290 (≠ A280), R292 (vs. gap), V293 (≠ T282), D310 (= D299), I311 (= I300), D329 (= D318), V330 (≠ A319), M405 (≠ Y388), G423 (≠ T406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N464)
- binding thiamine diphosphate: V400 (≠ M383), G401 (≠ T384), Q402 (= Q385), H403 (≠ L386), G426 (= G409), M428 (≠ L411), G452 (= G435), G454 (= G437), S455 (≠ G438), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468), M485 (≠ Q469), V486 (≠ I470)
Sites not aligning to the query:
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 9:486/582 of 1yi1A
- active site: Y33 (≠ I27), G35 (= G29), G36 (≠ V30), A37 (≠ H31), S38 (≠ T32), E59 (= E52), T82 (≠ I75), F121 (≠ L116), Q122 (≠ H117), E123 (= E118), K171 (≠ L167), M266 (≠ S255), V293 (≠ T282), V400 (≠ M383), G426 (= G409), M428 (≠ L411), D453 (= D436), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ Q469), V486 (≠ I470)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D281), R292 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R157), G223 (= G215), G224 (= G216), T246 (≠ S238), L247 (≠ V239), M248 (≠ A240), M263 (vs. gap), L264 (≠ A253), G265 (= G254), M266 (≠ S255), H267 (≠ T256), G286 (= G276), V287 (≠ T277), R288 (≠ E278), D290 (≠ A280), V293 (≠ T282), D310 (= D299), I311 (= I300), D329 (= D318), V330 (≠ A319), M405 (≠ Y388), G423 (≠ T406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N464), H482 (≠ A466)
Sites not aligning to the query:
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 9:486/582 of 1yi0A
- active site: Y33 (≠ I27), G35 (= G29), G36 (≠ V30), A37 (≠ H31), S38 (≠ T32), E59 (= E52), T82 (≠ I75), F121 (≠ L116), Q122 (≠ H117), E123 (= E118), K171 (≠ L167), M266 (≠ S255), V293 (≠ T282), V400 (≠ M383), G426 (= G409), M428 (≠ L411), D453 (= D436), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ Q469), V486 (≠ I470)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D281), R292 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G214), G223 (= G215), G224 (= G216), T246 (≠ S238), L247 (≠ V239), M248 (≠ A240), L264 (≠ A253), G265 (= G254), M266 (≠ S255), H267 (≠ T256), G286 (= G276), V287 (≠ T277), R288 (≠ E278), D290 (≠ A280), R292 (vs. gap), V293 (≠ T282), D310 (= D299), I311 (= I300), G328 (= G317), D329 (= D318), V330 (≠ A319), M405 (≠ Y388), G423 (≠ T406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N464), H482 (≠ A466)
Sites not aligning to the query:
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 9:486/582 of 1yhzA
- active site: Y33 (≠ I27), G35 (= G29), G36 (≠ V30), A37 (≠ H31), S38 (≠ T32), E59 (= E52), T82 (≠ I75), F121 (≠ L116), Q122 (≠ H117), E123 (= E118), K171 (≠ L167), M266 (≠ S255), V293 (≠ T282), V400 (≠ M383), G426 (= G409), M428 (≠ L411), D453 (= D436), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ Q469), V486 (≠ I470)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D281), R292 (vs. gap), M485 (≠ Q469)
- binding flavin-adenine dinucleotide: R161 (= R157), G223 (= G215), G224 (= G216), T246 (≠ S238), L247 (≠ V239), M248 (≠ A240), L264 (≠ A253), M266 (≠ S255), H267 (≠ T256), G286 (= G276), V287 (≠ T277), R288 (≠ E278), D290 (≠ A280), V293 (≠ T282), D310 (= D299), I311 (= I300), D329 (= D318), V330 (≠ A319), Q404 (≠ A387), M405 (≠ Y388), G423 (≠ T406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N464), H482 (≠ A466)
Sites not aligning to the query:
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 9:486/582 of 1yhyA
- active site: Y33 (≠ I27), G35 (= G29), G36 (≠ V30), A37 (≠ H31), S38 (≠ T32), E59 (= E52), T82 (≠ I75), F121 (≠ L116), Q122 (≠ H117), E123 (= E118), K171 (≠ L167), M266 (≠ S255), V293 (≠ T282), V400 (≠ M383), G426 (= G409), M428 (≠ L411), D453 (= D436), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ Q469), V486 (≠ I470)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D281), R292 (vs. gap), V486 (≠ I470)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G214), G223 (= G215), G224 (= G216), T246 (≠ S238), L247 (≠ V239), M248 (≠ A240), L264 (≠ A253), G265 (= G254), M266 (≠ S255), H267 (≠ T256), G286 (= G276), V287 (≠ T277), R288 (≠ E278), D290 (≠ A280), V293 (≠ T282), D310 (= D299), I311 (= I300), D329 (= D318), V330 (≠ A319), Q404 (≠ A387), M405 (≠ Y388), G423 (≠ T406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N464), H482 (≠ A466)
Sites not aligning to the query:
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
30% identity, 87% coverage: 3:470/535 of query aligns to 9:486/582 of 1ybhA
- active site: Y33 (≠ I27), G35 (= G29), G36 (≠ V30), A37 (≠ H31), S38 (≠ T32), E59 (= E52), T82 (≠ I75), F121 (≠ L116), Q122 (≠ H117), E123 (= E118), K171 (≠ L167), M266 (≠ S255), V293 (≠ T282), V400 (≠ M383), G426 (= G409), M428 (≠ L411), D453 (= D436), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ Q469), V486 (≠ I470)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (≠ S255), D291 (= D281), R292 (vs. gap), M485 (≠ Q469)
- binding flavin-adenine dinucleotide: R161 (= R157), G223 (= G215), G224 (= G216), T246 (≠ S238), L247 (≠ V239), M248 (≠ A240), L264 (≠ A253), M266 (≠ S255), H267 (≠ T256), G286 (= G276), V287 (≠ T277), R288 (≠ E278), D290 (≠ A280), V293 (≠ T282), D310 (= D299), I311 (= I300), D329 (= D318), V330 (≠ A319), Q404 (≠ A387), M405 (≠ Y388), G423 (≠ T406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N464), H482 (≠ A466)
Sites not aligning to the query:
6wo1A Hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit (see paper)
29% identity, 98% coverage: 6:530/535 of query aligns to 9:523/551 of 6wo1A
- active site: Y30 (≠ I27), G32 (= G29), G33 (≠ V30), A34 (≠ H31), I35 (≠ T32), E56 (= E52), T79 (≠ I75), F118 (≠ H117), Q119 (≠ E118), E120 (≠ T119), K168 (≠ L167), M255 (≠ C258), V282 (vs. gap), V398 (≠ M383), G424 (= G409), M426 (≠ L411), D451 (= D436), N478 (= N464)
- binding 2-methylpyrimidin-4-amine: G424 (= G409), T425 (= T410), M426 (≠ L411)
- binding diphosphate: V398 (≠ M383), G399 (≠ T384), Q400 (= Q385), H401 (≠ L386), G450 (= G435), D451 (= D436), A452 (≠ G437), S453 (≠ G438)
- binding flavin-adenine dinucleotide: D97 (= D93), R158 (= R157), G208 (= G214), G210 (= G216), S213 (≠ A219), T235 (≠ S238), L236 (≠ V239), Q237 (≠ A240), I253 (≠ T256), G254 (≠ L257), M255 (≠ C258), G275 (= G276), V276 (≠ T277), R277 (≠ E278), D279 (≠ A280), R281 (vs. gap), V282 (vs. gap), E308 (≠ D299), I309 (= I300), D327 (= D318), V328 (≠ A319), Q402 (≠ A387), G421 (≠ T406), G422 (= G407)
- binding magnesium ion: D451 (= D436), N478 (= N464)
Query Sequence
>GFF2097 FitnessBrowser__WCS417:GFF2097
MYDKAMTGGQALVRLLANYGVDTVFGIPGVHTLELYRGLPGSGIRHVLTRHEQGAGFMAD
GYARVSGKPGVCFVITGPGVTNAATAIGQAYADSIPMLVISSVNSTVSLGKGWGILHETQ
DQRAITAPITAFSAVALSAEDLPELVARAYAIFDSERPRPVHISVPLDVLAAPIQRDWSN
EVVRRPDRGLPPAKALDQGAAKLAAAKRPMIIAGGGALAAGEALQRLSTQLAAPFFTSVA
GKGLLPVNDPLNAGSTLCVEPGWQLISEADVVLAVGTEMADTDYWCERLPLGGELLRVDI
DARKFNDFYPCAVALKGDAQQTVLALLERLPTTARNAEAAISTVAALLHAIESGHGPLQS
IHQAILDRIEAELPANAFISSDMTQLAYTGNYAYRSRAPRSWLHPTGYGTLGYGLPAGIG
AKFGAPQRPGLVLVGDGGFLYTAQELATAVEELDSPLVVLLWNNDALGQIRDDMLSLDIA
PIGVLPRNPDFALFAQAFGCTVNQPRNLDELQTDLRNAFKRNGVTLIELKHACAC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory