SitesBLAST
Comparing GFF210 FitnessBrowser__Marino:GFF210 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6nqhA Xanthomonas citri dephospho-pgm in complex with xylose-1-phosphate
58% identity, 98% coverage: 1:441/452 of query aligns to 1:442/448 of 6nqhA
- active site: R12 (= R12), S97 (= S97), H98 (= H98), K107 (= K107), D237 (= D236), D239 (= D238), D241 (= D240), R242 (= R241), H324 (= H323)
- binding magnesium ion: D237 (= D236), D239 (= D238), D241 (= D240)
- binding 1-O-phosphono-alpha-D-xylopyranose: R12 (= R12), S97 (= S97), H98 (= H98), K107 (= K107), D239 (= D238), R242 (= R241), R280 (= R279), S301 (≠ T300), G302 (= G301), E320 (= E319), S322 (= S321), H324 (= H323), R414 (= R413), S416 (= S415), N417 (= N416), T418 (= T417), R423 (= R422)
6np8A Xanthomonas citri phospho-pgm in complex with mannose-6-phosphate (see paper)
58% identity, 98% coverage: 1:441/452 of query aligns to 1:442/448 of 6np8A
- active site: R12 (= R12), S97 (= S97), H98 (= H98), K107 (= K107), D237 (= D236), D239 (= D238), D241 (= D240), R242 (= R241), H324 (= H323)
- binding calcium ion: S97 (= S97), D237 (= D236), D239 (= D238), D241 (= D240)
- binding 6-O-phosphono-alpha-D-mannopyranose: Y9 (= Y9), R280 (= R279), G302 (= G301), H303 (= H302), E320 (= E319), S322 (= S321), H324 (= H323), R414 (= R413), S416 (= S415), N417 (= N416), T418 (= T417), R423 (= R422)
6nolA Xanthomonas citri dephospho-pgm in complex with mannose-1-phosphate (see paper)
58% identity, 98% coverage: 1:441/452 of query aligns to 1:442/448 of 6nolA
- active site: R12 (= R12), S97 (= S97), H98 (= H98), K107 (= K107), D237 (= D236), D239 (= D238), D241 (= D240), R242 (= R241), H324 (= H323)
- binding 1-O-phosphono-alpha-D-mannopyranose: G302 (= G301), E320 (= E319), S322 (= S321), H324 (= H323), R414 (= R413), S416 (= S415), N417 (= N416), T418 (= T417), R423 (= R422)
- binding magnesium ion: S97 (= S97), D237 (= D236), D239 (= D238), D241 (= D240)
6nnpA Xanthomonas citri dephospho-pgm in complex with glucose-6-phosphate (see paper)
58% identity, 98% coverage: 1:441/452 of query aligns to 1:442/448 of 6nnpA
- active site: R12 (= R12), S97 (= S97), H98 (= H98), K107 (= K107), D237 (= D236), D239 (= D238), D241 (= D240), R242 (= R241), H324 (= H323)
- binding 6-O-phosphono-alpha-D-glucopyranose: R280 (= R279), G302 (= G301), H303 (= H302), E320 (= E319), H324 (= H323), R414 (= R413), S416 (= S415), N417 (= N416), T418 (= T417), R423 (= R422)
- binding magnesium ion: S97 (= S97), D237 (= D236), D239 (= D238), D241 (= D240)
6nn2A Xanthomonas citri pgm apo-phospho (see paper)
58% identity, 98% coverage: 1:441/452 of query aligns to 1:442/448 of 6nn2A
- active site: R12 (= R12), S97 (= S97), H98 (= H98), K107 (= K107), D237 (= D236), D239 (= D238), D241 (= D240), R242 (= R241), H324 (= H323)
- binding calcium ion: S97 (= S97), D237 (= D236), D239 (= D238), D241 (= D240)
6n1eA Crystal structure of x. Citri phosphoglucomutase in complex with 1- methyl-glucose 6-phosphate (see paper)
58% identity, 98% coverage: 1:441/452 of query aligns to 1:442/448 of 6n1eA
6mnvA Crystal structure of x. Citri phosphoglucomutase in complex with ch2fg1p (see paper)
58% identity, 98% coverage: 1:441/452 of query aligns to 1:442/448 of 6mnvA
- binding 1-deoxy-1-fluoro-2-O-phosphono-alpha-D-gluco-hept-2-ulopyranose: R280 (= R279), G302 (= G301), E320 (= E319), S322 (= S321), H324 (= H323), R414 (= R413), S416 (= S415), N417 (= N416), T418 (= T417), R423 (= R422)
- binding magnesium ion: S97 (= S97), D237 (= D236), D239 (= D238), D241 (= D240)
6mlhA Crystal structure of x. Citri phosphoglucomutase in complex with glucopyranosyl-1-methyl-phosphonic acid (see paper)
58% identity, 98% coverage: 1:441/452 of query aligns to 1:442/448 of 6mlhA
- active site: R12 (= R12), S97 (= S97), H98 (= H98), K107 (= K107), D237 (= D236), D239 (= D238), D241 (= D240), R242 (= R241), H324 (= H323)
- binding (1S)-1,5-anhydro-1-(phosphonomethyl)-D-glucitol: R280 (= R279), G302 (= G301), E320 (= E319), H324 (= H323), R414 (= R413), S416 (= S415), N417 (= N416), T418 (= T417), R423 (= R422)
- binding magnesium ion: S97 (= S97), D237 (= D236), D239 (= D238), D241 (= D240)
6mlfA Crystal structure of x. Citri phosphoglucomutase in complex with 6- fluoro glucose 1-phosphate (see paper)
58% identity, 98% coverage: 1:441/452 of query aligns to 1:442/448 of 6mlfA
- active site: R12 (= R12), S97 (= S97), H98 (= H98), K107 (= K107), D237 (= D236), D239 (= D238), D241 (= D240), R242 (= R241), H324 (= H323)
- binding 6-deoxy-6-fluoro-1-O-phosphono-alpha-D-glucopyranose: R280 (= R279), G302 (= G301), E320 (= E319), H324 (= H323), R414 (= R413), S416 (= S415), T418 (= T417), R423 (= R422)
- binding magnesium ion: S97 (= S97), D237 (= D236), D239 (= D238), D241 (= D240)
5kl0A Crystal structure of phosphoglucomutase from xanthomonas citri citri complexed with glucose-1,6-biphosphate (see paper)
58% identity, 98% coverage: 1:441/452 of query aligns to 1:442/448 of 5kl0A
- active site: R12 (= R12), S97 (= S97), H98 (= H98), K107 (= K107), D237 (= D236), D239 (= D238), D241 (= D240), R242 (= R241), H324 (= H323)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: S97 (= S97), G302 (= G301), H303 (= H302), E320 (= E319), H324 (= H323), R414 (= R413), S416 (= S415), N417 (= N416), R423 (= R422)
- binding magnesium ion: S97 (= S97), D237 (= D236), D239 (= D238), D241 (= D240)
6mlwA Crystal structure of x. Citri phosphoglucomutase in complex with 2- fluoro mannosyl-1-methyl-phosphonic acid (see paper)
58% identity, 98% coverage: 1:441/452 of query aligns to 2:443/449 of 6mlwA
- active site: R13 (= R12), S98 (= S97), H99 (= H98), K108 (= K107), D238 (= D236), D240 (= D238), D242 (= D240), R243 (= R241), H325 (= H323)
- binding 2,6-anhydro-5,7-dideoxy-5-fluoro-7-phosphono-D-glycero-D-manno-heptitol: G303 (= G301), H304 (= H302), E321 (= E319), S323 (= S321), H325 (= H323), R415 (= R413), S417 (= S415), N418 (= N416), T419 (= T417), R424 (= R422)
- binding magnesium ion: S98 (= S97), D238 (= D236), D240 (= D238), D242 (= D240)
5bmpA Crystal structure of phosphoglucomutase from xanthomonas citri complexed with glucose-1-phosphate (see paper)
58% identity, 98% coverage: 1:441/452 of query aligns to 2:443/449 of 5bmpA
- active site: R13 (= R12), S98 (= S97), H99 (= H98), K108 (= K107), D238 (= D236), D240 (= D238), D242 (= D240), R243 (= R241), H325 (= H323)
- binding 1-O-phosphono-alpha-D-glucopyranose: R281 (= R279), G303 (= G301), E321 (= E319), S323 (= S321), H325 (= H323), R415 (= R413), S417 (= S415), N418 (= N416), T419 (= T417), R424 (= R422)
- binding magnesium ion: S98 (= S97), D238 (= D236), D240 (= D238), D242 (= D240)
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
31% identity, 97% coverage: 4:442/452 of query aligns to 3:443/455 of 1wqaA
- active site: R11 (= R12), S101 (= S97), H102 (= H98), K111 (= K107), D243 (= D236), D245 (= D238), D247 (= D240), R248 (= R241), G330 (≠ H323), R340 (≠ D333)
- binding magnesium ion: S101 (= S97), D243 (= D236), D245 (= D238), D247 (= D240)
P26276 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 10 papers)
31% identity, 96% coverage: 4:438/452 of query aligns to 12:446/463 of P26276
- R15 (≠ K7) mutation to A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 25-fold.
- Y17 (= Y9) binding ; binding
- R20 (= R12) mutation to A: No phosphoglucomutase activity.
- S108 (= S97) binding via phosphate group; modified: Phosphoserine; mutation S->A,V: About 5% activity, still subject to substrate inhibition and requires G1,6P as an activator; phosphorylation occurs at a different site.; mutation to C: KM for G1P unchanged, kcat decreases 24-fold; G1,6P stimulates reaction by 2-3 orders of magnitude. No stable protein phosphorylation detected, altered ligation of metal residue.
- N110 (= N99) mutation to A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 30-fold.
- D242 (= D236) binding
- D244 (= D238) binding
- D246 (= D240) binding
- R247 (= R241) mutation to A: Small reduction in KM, small increase in dissociation of G1,6P intermediate.
- R262 (≠ Y256) mutation to A: Increases KM 2-fold, decreases kcat 9-fold for G1P. Alters flexibility of the hinge region.
- K285 (≠ R279) binding
- H308 (= H302) binding ; binding
- E325 (= E319) mutation to A: Reduces KM and Vmax approximately 2-fold.
- EMSGH 325:329 (≠ EMSAH 319:323) binding ; binding
- H329 (= H323) mutation to A: No phosphoglucomutase activity using G1P as substrate, protein is less easily phosphorylated, no significant change in structure.
- P368 (≠ E362) mutation to G: Increases KM 2-fold, decreases kcat 6-fold for G1P. Alters flexibility of the hinge region, structure is less compact.
- R421 (= R413) mutation to C: Loss of phosphomannomutase activity, very low phosphoglucomutase activity.
- RASNT 421:425 (≠ RMSNT 413:417) binding ; binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q02E40 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
31% identity, 96% coverage: 4:438/452 of query aligns to 12:446/463 of Q02E40
- S108 (= S97) active site, Non-phosphorylated intermediate; modified: Phosphoserine
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
31% identity, 96% coverage: 4:438/452 of query aligns to 4:438/455 of 2h5aX
- active site: H101 (= H98), D234 (= D236), D236 (= D238), D238 (= D240), R239 (= R241), D332 (= D333)
- binding 1-O-phosphono-alpha-D-xylopyranose: Y9 (= Y9), T298 (= T300), G299 (= G301), H300 (= H302), E317 (= E319), S319 (= S321), H321 (= H323), R413 (= R413), S415 (= S415), N416 (= N416), T417 (= T417)
- binding zinc ion: S100 (= S97), D234 (= D236), D236 (= D238), D238 (= D240)
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
31% identity, 96% coverage: 4:438/452 of query aligns to 4:438/455 of 2h4lX
- active site: H101 (= H98), D234 (= D236), D236 (= D238), D238 (= D240), R239 (= R241), D332 (= D333)
- binding 1-O-phosphono-alpha-D-ribofuranose: Y9 (= Y9), R12 (= R12), S100 (= S97), T298 (= T300), E317 (= E319), R413 (= R413), S415 (= S415), N416 (= N416), T417 (= T417)
- binding zinc ion: S100 (= S97), D234 (= D236), D236 (= D238), D238 (= D240)
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
31% identity, 96% coverage: 4:438/452 of query aligns to 4:438/455 of 2fkfA
- active site: R12 (= R12), S100 (= S97), H101 (= H98), K110 (= K107), D234 (= D236), D236 (= D238), D238 (= D240), R239 (= R241), H321 (= H323), D332 (= D333)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: R7 (≠ K7), H101 (= H98), S319 (= S321), R413 (= R413), S415 (= S415), N416 (= N416), T417 (= T417)
- binding zinc ion: S100 (= S97), D234 (= D236), D236 (= D238), D238 (= D240)
1pcmX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
31% identity, 96% coverage: 4:438/452 of query aligns to 4:438/455 of 1pcmX
- active site: R12 (= R12), S100 (= S97), H101 (= H98), K110 (= K107), D234 (= D236), D236 (= D238), D238 (= D240), R239 (= R241), H321 (= H323), D332 (= D333)
- binding 6-O-phosphono-alpha-D-mannopyranose: Y9 (= Y9), S100 (= S97), T298 (= T300), G299 (= G301), H300 (= H302), E317 (= E319), S319 (= S321), H321 (= H323), R413 (= R413), S415 (= S415)
- binding zinc ion: S100 (= S97), D234 (= D236), D236 (= D238), D238 (= D240)
1p5gX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
31% identity, 96% coverage: 4:438/452 of query aligns to 4:438/455 of 1p5gX
- active site: R12 (= R12), S100 (= S97), H101 (= H98), K110 (= K107), D234 (= D236), D236 (= D238), D238 (= D240), R239 (= R241), H321 (= H323), D332 (= D333)
- binding 6-O-phosphono-alpha-D-glucopyranose: Y9 (= Y9), S100 (= S97), K277 (≠ R279), G299 (= G301), H300 (= H302), E317 (= E319), S319 (= S321), H321 (= H323), R413 (= R413), S415 (= S415), N416 (= N416), T417 (= T417)
- binding zinc ion: S100 (= S97), D234 (= D236), D236 (= D238), D238 (= D240)
Query Sequence
>GFF210 FitnessBrowser__Marino:GFF210
MDLSCFKAYDLRGRVPDQLNPVLAEKIGRAYVEITGAKKVIVGYDIRLSSPDIAEALSSG
LMAAGADVFDIGLCGTEQVYFATSHYKMDGGIMVTASHNPKDHNGMKMVGPESRPISSDN
GLNEIRDRVLEPFGDAPQQGRYEPLEVMSAYVDHLLGYIDAGSLSPLTIVCNAGNGGAGL
VIDELEQHLPFEFVKVHHQPDGHFPNGVPNPILPENRAATADAVIAEGAAMGIAWDGDYD
RCFFFDENGRFIEGYYIVGLLADQFLRKTGGGKVIHDPRLTWNTMDLVKAAGGEAIESKT
GHAFIKQRMRDEDAVYGGEMSAHHYFRDFAYCDSGMIPWLLVAERLCQSGQTLSSLIDAR
IEAYPASGEINRTIDDPPKVIAAIEAKYSVGAKSVSHVDGVSIEFDDWRFNLRMSNTEPV
VRLNVESRADIPLMEEKTEELLAEMQRLNEER
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory