Comparing GFF210 FitnessBrowser__WCS417:GFF210 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
45% identity, 91% coverage: 32:370/371 of query aligns to 2:343/343 of P30750
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
45% identity, 91% coverage: 32:370/371 of query aligns to 3:344/344 of 3tuzC
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
45% identity, 91% coverage: 32:370/371 of query aligns to 3:344/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
45% identity, 91% coverage: 32:370/371 of query aligns to 3:344/344 of 6cvlD
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
47% identity, 65% coverage: 32:273/371 of query aligns to 3:241/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
44% identity, 63% coverage: 37:269/371 of query aligns to 9:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
44% identity, 63% coverage: 37:269/371 of query aligns to 9:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
44% identity, 63% coverage: 37:269/371 of query aligns to 9:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
44% identity, 63% coverage: 37:269/371 of query aligns to 9:239/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
42% identity, 64% coverage: 34:271/371 of query aligns to 3:239/240 of 4ymuJ
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
41% identity, 58% coverage: 32:247/371 of query aligns to 2:216/222 of 8i6rB
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 73% coverage: 43:312/371 of query aligns to 37:320/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
33% identity, 73% coverage: 43:312/371 of query aligns to 37:320/382 of 7aheC
7ahdC Opua (e190q) occluded (see paper)
37% identity, 60% coverage: 43:265/371 of query aligns to 37:260/260 of 7ahdC
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
41% identity, 58% coverage: 32:246/371 of query aligns to 2:215/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
41% identity, 58% coverage: 32:246/371 of query aligns to 2:215/219 of 8w6iD
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
42% identity, 63% coverage: 28:260/371 of query aligns to 1:241/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
42% identity, 63% coverage: 28:260/371 of query aligns to 5:245/258 of P02915
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
41% identity, 58% coverage: 32:246/371 of query aligns to 2:215/218 of 8hd0A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 58% coverage: 32:246/371 of query aligns to 2:223/232 of 1f3oA
>GFF210 FitnessBrowser__WCS417:GFF210
MTAANAQVRDLGLPPRDAEQTELHPDLNRAHVRFINLGKTYDGTVHALQGIDLAIQRGEV
FGIIGRSGAGKSSLIRTINRLEQPSSGRVLIDQVDIGAFDEDRLVALRRRIGMIFQHFNL
MSAKTVWQNVELPLKVAGIPKLQREQKVRELLELVGLKDKHKAYPAQLSGGQKQRVGIAR
SLVHDPEILLCDEATSALDPETTQSILGLLREINQRLGLTIVLITHEMAVIREICDRVVV
LEHGRIVEQGPVWQVFGDPQHAVSKTLLAPLQHGLPEELQSRLQARPATADAAVVLRLQF
TGSDTDEPDLAALFSALGGRVRLLQGGVERIQGHALGQLLLAVNGSPHTAEELRNRAGNW
AQQVEVLGHVV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory