SitesBLAST
Comparing GFF2105 FitnessBrowser__psRCH2:GFF2105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ijrF 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD+
60% identity, 98% coverage: 7:285/285 of query aligns to 11:290/290 of 3ijrF
- active site: G57 (= G52), S182 (= S177), L192 (= L187), Y195 (= Y190), K199 (= K194), K240 (≠ D235)
- binding magnesium ion: D55 (= D50), S56 (= S51), E80 (≠ Q75)
- binding nicotinamide-adenine-dinucleotide: P21 (= P16), D55 (= D50), S56 (= S51), G57 (= G52), I58 (= I53), Y77 (= Y72), L78 (= L73), E80 (≠ Q75), G103 (= G98), D104 (= D99), L105 (≠ V100), N131 (= N126), V132 (≠ A127), A133 (= A128), Q134 (≠ E129), I155 (≠ T150), T180 (= T175), S182 (= S177), Y195 (= Y190), K199 (= K194), P225 (= P220), G226 (= G221), P227 (= P222), I228 (= I223), T230 (= T225), L232 (= L227)
3i3oA 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD-acetone
60% identity, 98% coverage: 7:285/285 of query aligns to 3:282/282 of 3i3oA
- active site: G49 (= G52), S174 (= S177), L184 (= L187), Y187 (= Y190), K191 (= K194), K232 (≠ D235)
- binding magnesium ion: D47 (= D50), S48 (= S51), E72 (≠ Q75)
- binding nicotinamide adenine dinucleotide acetone adduct: G45 (= G48), D47 (= D50), S48 (= S51), G49 (= G52), I50 (= I53), Y69 (= Y72), L70 (= L73), E72 (≠ Q75), G95 (= G98), D96 (= D99), L97 (≠ V100), N123 (= N126), V124 (≠ A127), A125 (= A128), Q126 (≠ E129), Q127 (= Q130), I147 (≠ T150), T172 (= T175), S174 (= S177), Y187 (= Y190), K191 (= K194), P217 (= P220), G218 (= G221), I220 (= I223), T222 (= T225), L224 (= L227)
5jydB Crystal structure of a putative short chain dehydrogenase from burkholderia cenocepacia
49% identity, 96% coverage: 8:280/285 of query aligns to 14:288/292 of 5jydB
- active site: G58 (= G52), S184 (= S177), L194 (= L187), Y197 (= Y190), K201 (= K194), P242 (≠ D235)
- binding magnesium ion: D56 (= D50), S57 (= S51), E82 (≠ Q75)
- binding nicotinamide-adenine-dinucleotide: G54 (= G48), D56 (= D50), S57 (= S51), G58 (= G52), I59 (= I53), L79 (= L73), E82 (≠ Q75), D106 (= D99), I107 (≠ V100), N133 (= N126), A134 (= A127), A135 (= A128), T182 (= T175), S184 (= S177), Y197 (= Y190), K201 (= K194), P227 (= P220), G228 (= G221), P229 (= P222), Y230 (≠ I223), T232 (= T225), L234 (= L227), Q235 (≠ I228)
P0AG84 Uncharacterized oxidoreductase YghA; EC 1.-.-.- from Escherichia coli (strain K12) (see paper)
47% identity, 95% coverage: 9:280/285 of query aligns to 17:290/294 of P0AG84
- K39 (≠ E31) modified: N6-acetyllysine
3r3sA Structure of the ygha oxidoreductase from salmonella enterica
47% identity, 95% coverage: 9:280/285 of query aligns to 15:288/292 of 3r3sA
- active site: G58 (= G52), S184 (= S177), L194 (= L187), Y197 (= Y190), K201 (= K194), Q242 (≠ A234)
- binding magnesium ion: D56 (= D50), S57 (= S51), E82 (≠ Q75)
- binding nicotinamide-adenine-dinucleotide: D56 (= D50), S57 (= S51), G58 (= G52), I59 (= I53), L79 (= L73), E82 (≠ Q75), D106 (= D99), L107 (≠ V100), V133 (≠ N126), A134 (= A127), G135 (≠ A128), S184 (= S177), Y197 (= Y190), K201 (= K194), P227 (= P220), G228 (= G221), I230 (= I223), T232 (= T225), L234 (= L227), Q235 (vs. gap)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
38% identity, 85% coverage: 38:280/285 of query aligns to 8:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G48), S20 (≠ D50), K21 (≠ S51), G22 (= G52), I23 (= I53), A43 (≠ L73), S44 (≠ D74), S45 (≠ Q75), G68 (= G98), D69 (= D99), V70 (= V100), N96 (= N126), S97 (≠ A127), G98 (≠ A128), Y100 (≠ H131), I144 (≠ T175), S146 (= S177), Y159 (= Y190), K163 (= K194), P189 (= P220), G190 (= G221), M191 (≠ P222), I192 (= I223), T194 (= T225), G196 (≠ L227), T197 (≠ I228)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S177), Y159 (= Y190), M191 (≠ P222), I202 (vs. gap)
5ojiA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
37% identity, 86% coverage: 38:281/285 of query aligns to 7:256/260 of 5ojiA
- active site: G21 (= G52), S148 (= S177), Y161 (= Y190), K165 (= K194)
- binding isatin: S148 (= S177), S150 (≠ T179), Y161 (= Y190), V193 (≠ P222), S199 (≠ I228), L202 (≠ T231)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G48), T19 (≠ D50), I22 (= I53), S41 (≠ Y72), R42 (≠ L73), N43 (≠ D74), N46 (≠ Q77), I69 (≠ V100), N95 (= N126), H96 (≠ A127), G97 (≠ A128), N146 (≠ T175), S148 (= S177), Y161 (= Y190), K165 (= K194), G192 (= G221), I194 (= I223), T196 (= T225), M198 (≠ L227)
5ojgA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
37% identity, 86% coverage: 38:281/285 of query aligns to 7:256/260 of 5ojgA
- active site: G21 (= G52), S148 (= S177), Y161 (= Y190), K165 (= K194)
- binding butane-2,3-dione: S148 (= S177), Y161 (= Y190)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G48), T19 (≠ D50), G21 (= G52), I22 (= I53), S41 (≠ Y72), R42 (≠ L73), N43 (≠ D74), N46 (≠ Q77), I69 (≠ V100), N95 (= N126), H96 (≠ A127), G97 (≠ A128), N146 (≠ T175), S148 (= S177), Y161 (= Y190), K165 (= K194), P191 (= P220), I194 (= I223), T196 (= T225), M198 (≠ L227)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
36% identity, 84% coverage: 42:280/285 of query aligns to 5:243/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
36% identity, 84% coverage: 42:280/285 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G52), S138 (= S177), Q148 (≠ L187), Y151 (= Y190), K155 (= K194)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G48), S10 (≠ D50), R11 (≠ S51), I13 (= I53), N31 (≠ L71), Y32 (= Y72), A33 (≠ L73), G34 (≠ D74), S35 (≠ Q75), A58 (≠ G98), N59 (≠ D99), V60 (= V100), N86 (= N126), A87 (= A127), T109 (= T150), S138 (= S177), Y151 (= Y190), K155 (= K194), P181 (= P220), G182 (= G221)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
37% identity, 83% coverage: 45:280/285 of query aligns to 8:249/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G48), S13 (≠ D50), R14 (≠ S51), G15 (= G52), I16 (= I53), L36 (= L73), R37 (≠ D74), N38 (≠ Q75), A61 (≠ G98), D62 (= D99), V63 (= V100), N89 (= N126), A90 (= A127), G91 (≠ A128), T113 (= T150), V143 (≠ T175), S145 (= S177), Y159 (= Y190), K163 (= K194), P189 (= P220), G190 (= G221), I192 (= I223), T194 (= T225), I196 (≠ L227), H197 (≠ I228)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 86% coverage: 38:283/285 of query aligns to 4:244/244 of 4nbuB
- active site: G18 (= G52), N111 (= N151), S139 (= S177), Q149 (≠ L187), Y152 (= Y190), K156 (= K194)
- binding acetoacetyl-coenzyme a: D93 (≠ Q133), K98 (≠ D138), S139 (= S177), N146 (≠ S184), V147 (≠ P185), Q149 (≠ L187), Y152 (= Y190), F184 (≠ P222), M189 (≠ L227), K200 (≠ E239)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G48), N17 (≠ S51), G18 (= G52), I19 (= I53), D38 (≠ Y72), F39 (≠ L73), V59 (≠ G98), D60 (= D99), V61 (= V100), N87 (= N126), A88 (= A127), G89 (≠ A128), I90 (≠ E129), T137 (= T175), S139 (= S177), Y152 (= Y190), K156 (= K194), P182 (= P220), F184 (≠ P222), T185 (≠ I223), T187 (= T225), M189 (≠ L227)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
33% identity, 85% coverage: 39:280/285 of query aligns to 11:255/267 of 3ay6B
- active site: G24 (= G52), S151 (= S177), Y164 (= Y190), K168 (= K194)
- binding beta-D-glucopyranose: E102 (≠ Q130), S151 (= S177), H153 (≠ T179), W158 (≠ S184), Y164 (= Y190), N202 (≠ I228), K205 (≠ T231)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G48), T23 (≠ S51), G24 (= G52), L25 (≠ I53), Y45 (≠ L73), D71 (= D99), V72 (= V100), N98 (= N126), A99 (= A127), G100 (≠ A128), V101 (≠ E129), M149 (≠ T175), S151 (= S177), Y164 (= Y190), K168 (= K194), P194 (= P220), G195 (= G221), M197 (≠ I223), T199 (= T225), P200 (= P226), I201 (≠ L227), N202 (≠ I228)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
33% identity, 85% coverage: 39:280/285 of query aligns to 5:249/261 of P40288
- 11:35 (vs. 45:69, 48% identical) binding
- E96 (≠ Q130) mutation E->A,G,K: Heat stable.
- D108 (≠ Q143) mutation to N: Heat stable.
- V112 (≠ T147) mutation to A: Heat stable.
- E133 (≠ K168) mutation to K: Heat stable.
- V183 (= V215) mutation to I: Heat stable.
- P194 (= P226) mutation to Q: Heat stable.
- E210 (≠ G241) mutation to K: Heat stable.
- Y217 (≠ R248) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
33% identity, 85% coverage: 39:280/285 of query aligns to 5:249/261 of 1g6kA
- active site: G18 (= G52), S145 (= S177), Y158 (= Y190), K162 (= K194)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S51), G18 (= G52), L19 (≠ I53), R39 (≠ L73), D65 (= D99), V66 (= V100), N92 (= N126), A93 (= A127), G94 (≠ A128), M143 (≠ T175), S145 (= S177), Y158 (= Y190), P188 (= P220), G189 (= G221), I191 (= I223), T193 (= T225)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
35% identity, 85% coverage: 39:280/285 of query aligns to 3:242/248 of Q9KJF1
- S15 (= S51) binding
- D36 (≠ H76) binding
- D62 (= D99) binding
- I63 (≠ V100) binding
- N89 (= N126) binding
- Y153 (= Y190) binding
- K157 (= K194) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
35% identity, 85% coverage: 39:280/285 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G48), M16 (≠ I53), D35 (≠ H76), I36 (≠ Q77), I62 (≠ V100), N88 (= N126), G90 (≠ A128), I138 (≠ T175), S140 (= S177), Y152 (= Y190), K156 (= K194), I185 (= I223)
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
35% identity, 85% coverage: 38:280/285 of query aligns to 4:241/245 of 5t5qC
- active site: G18 (= G52), S140 (= S177), N150 (≠ L187), Y153 (= Y190), K157 (= K194)
- binding nicotinamide-adenine-dinucleotide: N16 (≠ D50), G17 (≠ S51), G18 (= G52), I19 (= I53), D38 (≠ Y72), L39 (= L73), D63 (= D99), A64 (≠ V100), S90 (≠ N126), I113 (≠ T150), Y153 (= Y190), K157 (= K194), P182 (= P220), I185 (= I223), T187 (= T225), M189 (≠ L227)
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
36% identity, 84% coverage: 42:280/285 of query aligns to 3:247/248 of 4iqgD
- active site: G13 (= G52), N112 (= N151), S143 (= S177), Y154 (≠ L187), Y157 (= Y190), K161 (= K194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G48), S11 (≠ D50), R12 (≠ S51), G13 (= G52), I14 (= I53), N32 (≠ L71), A34 (≠ L73), S35 (≠ D74), N36 (≠ Q75), A59 (≠ G98), D60 (= D99), V61 (= V100), N87 (= N126), A88 (= A127), G89 (≠ A128), V141 (≠ T175), S143 (= S177), Y157 (= Y190), K161 (= K194), P187 (= P220), G188 (= G221), I190 (= I223), T192 (= T225), I194 (≠ L227), H195 (≠ I228)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
37% identity, 85% coverage: 38:280/285 of query aligns to 3:245/249 of 4bmsF
- active site: S137 (= S177), H147 (≠ L187), Y150 (= Y190), K154 (= K194), Q195 (≠ T231)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G48), N15 (≠ D50), S16 (= S51), I18 (= I53), R38 (≠ Q77), R39 (≠ D78), A59 (≠ G98), D60 (= D99), V61 (= V100), N87 (= N126), S88 (≠ A127), G89 (≠ A128), V110 (≠ T150), S137 (= S177), Y150 (= Y190), K154 (= K194), G181 (= G221), I183 (= I223), T185 (= T225), I187 (≠ L227)
Query Sequence
>GFF2105 FitnessBrowser__psRCH2:GFF2105
MAEDNQTLPPQEQPEPGKEGLMNPRPEYRGEDYKAAGKLEGKTAIITGGDSGIGRSVAVL
FAREGADVAILYLDQHQDAEETRTVVEQYGRRCLTFAGDVADRDVCRKVIDETLAAFGKL
DILVNNAAEQHPQEKLEDISEEQWEKTFRTNIFGMFQMTKAVLPHLGKGASIINTTSVTA
YKGSPQLLDYSATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLISSTFDADEVAEF
GSNTPMKRPGQPDEVAPAYVYLASSDAAYVSGQVIHVNGGTVVNG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory