SitesBLAST
Comparing GFF2118 PGA1_c21510 methylmalonyl-CoA mutase BhbA to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P22033 Methylmalonyl-CoA mutase, mitochondrial; MCM; Methylmalonyl-CoA isomerase; EC 5.4.99.2 from Homo sapiens (Human) (see 28 papers)
65% identity, 98% coverage: 7:701/707 of query aligns to 42:736/750 of P22033
- Q50 (≠ E15) binding
- I69 (≠ V34) to V: in MMAM; likely benign; dbSNP:rs115923556
- P86 (= P53) to L: in MMAM; mut0 and mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs769348060
- G87 (= G54) to E: in MMAM; mut0; dbSNP:rs1554160986
- R93 (= R60) to H: in MMAM; mut0; decreased methylmalonyl-CoA mutase activity; dbSNP:rs121918251
- G94 (= G61) to R: in MMAM; mut0; dbSNP:rs727504022; to V: in MMAM; mut- and mut0; dbSNP:rs535411418
- P95 (≠ V62) to R: in MMAM; mut0; dbSNP:rs190834116
- YPTM 96:99 (≠ KATM 63:66) binding
- Y100 (= Y67) to C: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs864309735
- W105 (= W72) to R: in MMAM; mut0; dbSNP:rs121918249
- TIRQY 106:110 (= TIRQY 73:77) binding
- R108 (= R75) to C: in MMAM; mut0; dbSNP:rs121918257; to G: in MMAM; mut-; to H: in MMAM; mut0; dbSNP:rs483352778
- Q109 (= Q76) to R: in MMAM; mut0; dbSNP:rs1461110052
- G133 (= G100) to R: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253828
- A137 (= A104) to V: in MMAM; mut0; dbSNP:rs941483851
- D139 (= D106) to N: in MMAM; uncertain significance; dbSNP:rs879253829
- L140 (= L107) to P: in MMAM; decreased protein expression; decreased methylmalonyl-CoA mutase activity
- A141 (= A108) to T: in MMAM; decreased protein expression; dbSNP:rs1554160730
- H143 (= H110) to Y: in MMAM; mut0
- G145 (= G112) to S: in MMAM; mut0
- S148 (= S115) to L: in MMAM; mut0; dbSNP:rs1300547552
- D156 (= D123) to N: in MMAM; mut-
- G158 (= G125) to V: in MMAM; mut0
- G161 (= G128) to R: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; to V: in MMAM; decreased protein expression
- F174 (= F141) to S: in MMAM; mut0; dbSNP:rs864309733
- M186 (= M153) to V: in MMAM; mut-; dbSNP:rs148331800
- T187 (= T154) to S: in MMAM; mut0; dbSNP:rs879253830
- N189 (= N156) to I: in MMAM; mut-; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs200908035; to K: in MMAM; mut-; dbSNP:rs1561959114
- A191 (= A158) to E: in MMAM; mut- and mut0; affects proper folding; reduced protein level; decreased methylmalonyl-CoA mutase activity; dbSNP:rs760782399
- A197 (= A164) to E: in MMAM; mut0
- G203 (= G170) to R: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs778702777
- E205 (= E172) natural variant: Missing (in MMAM; mut0; dbSNP:rs879253831)
- G215 (= G182) to C: in MMAM; mut- and mut0; dbSNP:rs121918258; to S: in MMAM; mut0; dbSNP:rs121918258
- TIQ 216:218 (= TIQ 183:185) binding
- Q218 (= Q185) to H: in MMAM; mut0 and mut-; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; alters thermodynamic stability; dbSNP:rs1446389693
- N219 (= N186) to Y: in MMAM; mut0; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; dbSNP:rs121918256
- R228 (= R195) binding ; to Q: in MMAM; mut0; dbSNP:rs770810987
- T230 (= T197) to I: in MMAM; mut-; to R: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253833
- Y231 (= Y198) to N: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; strong decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs864309736
- K255 (= K222) binding
- S262 (= S229) to N: in MMAM; mut0
- H265 (= H232) binding ; to Y: in MMAM; mut-
- E276 (= E243) to D: in MMAM; uncertain significance; mut-; dbSNP:rs12175488
- L281 (= L248) to S: in MMAM; mut0; dbSNP:rs796052007
- G284 (= G251) to E: in MMAM; mut0; dbSNP:rs879253835; to R: in MMAM; mut0; dbSNP:rs761477436
- S288 (≠ V255) to P: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs1179778233
- G291 (≠ A258) to E: in MMAM; mut0
- Q293 (≠ E260) to P: in MMAM; mut0
- RLS 304:306 (= RLS 271:273) binding
- L305 (= L272) to S: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs1554160246
- S306 (= S273) to F: in MMAM; mut0; dbSNP:rs1085307929
- W309 (≠ F276) to G: in MMAM; decreased protein expression
- G312 (= G279) to V: in MMAM; mut0; dbSNP:rs864309734
- Y316 (≠ F283) to C: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; no decreased affinity for adenosylcob(III)alamin; dbSNP:rs781474200
- A324 (= A291) to T: in MMAM; mut-; dbSNP:rs780387525
- R326 (= R293) to K: in MMAM; uncertain significance; dbSNP:rs758577372
- L328 (= L295) to F: in MMAM; mut0; affects proper folding; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; dbSNP:rs796052002; to P: in MMAM; mut0; dbSNP:rs965316043
- S344 (= S310) to F: in MMAM; mut-; affects proper folding; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin
- L346 (≠ M312) natural variant: Missing (in MMAM; mut0)
- L347 (= L313) to R: in MMAM; mut0; dbSNP:rs1026703654
- H350 (= H316) to Y: in MMAM; mut0; dbSNP:rs1407914109
- L358 (= L324) to P: in MMAM; mut0
- N366 (= N332) to S: in MMAM; mut-; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs864309737
- R369 (= R335) to C: in MMAM; mut0; dbSNP:rs772552898; to H: in MMAM; mut- and mut0; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; alters thermodynamic stability; dbSNP:rs564069299
- T370 (= T336) to P: in MMAM; mut0; dbSNP:rs368790885
- A377 (= A343) to E: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs121918250
- Q383 (= Q349) to H: in MMAM; mut0; to P: in MMAM; mut0
- H386 (= H352) to N: in MMAM; mut0; dbSNP:rs1554159937; to R: in MMAM; mut0; dbSNP:rs866933356
- T387 (= T353) to I: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability
- N388 (= N354) to H: in MMAM; mut0; dbSNP:rs766010704; to K: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253840
- S389 (≠ A355) natural variant: Missing (in MMAM; mut0)
- I412 (≠ L378) natural variant: Missing (in MMAM; mut0)
- P424 (= P390) to L: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253842
- G426 (≠ A392) to E: in MMAM; mut-; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs533755473; to R: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; strong decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs769922244
- G427 (= G393) to D: in MMAM; mut0; dbSNP:rs753288303
- G454 (= G420) to E: in MMAM; mut0
- A499 (≠ P465) to T: in dbSNP:rs2229385
- I505 (≠ V471) to T: in MMAM; decreased protein expression; decreased methylmalonyl-CoA mutase activity
- Q514 (= Q480) to E: in MMAM; uncertain significance; to K: in MMAM; decreased protein expression
- L518 (= L484) to P: in MMAM; mut0; dbSNP:rs864309738
- R532 (≠ A498) to H: in dbSNP:rs1141321
- A535 (≠ D501) to P: in MMAM; mut0; dbSNP:rs760183775
- A552 (= A517) to V: in MMAM; uncertain significance; dbSNP:rs879253845
- C560 (≠ A525) to Y: in MMAM; mut0; dbSNP:rs1238333040
- T566 (≠ S531) to R: in MMAM; mut0
- F573 (= F538) to S: in MMAM; mut-; affects proper folding; no effect on protein abundance; no effect on methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; does not alter thermodynamic stability; dbSNP:rs775593146
- Y587 (= Y552) to C: in MMAM; mut-
- I597 (≠ F562) to R: in MMAM; no changed in protein expression; decreased methylmalonyl-CoA mutase activity; dbSNP:rs1554158951
- P615 (= P580) to L: in MMAM; mut0; affects proper folding; reduced strongly protein level; to R: in MMAM; mut0; dbSNP:rs1554158777; to T: in MMAM; mut0; affects proper folding; reduced strongly protein level; loss of methylmalonyl-CoA mutase activity; dbSNP:rs1302409621
- R616 (= R581) to C: in MMAM; mut0; dbSNP:rs765284825
- L617 (= L582) to R: in MMAM; mut0; dbSNP:rs1554158775
- K621 (= K586) to N: in MMAM; mut0
- G623 (= G588) to R: in MMAM; mut0; dbSNP:rs121918254
- Q624 (= Q589) to R: in MMAM; no effect on protein abundance; dbSNP:rs768521956
- D625 (= D590) to G: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253847; to V: in MMAM; mut0; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity
- G626 (= G591) to C: in MMAM; mut-; dbSNP:rs982110849
- H627 (= H592) binding axial binding residue; to R: in MMAM; mut0; dbSNP:rs372486357
- G630 (= G595) to E: in MMAM; mut0; dbSNP:rs143023066
- V633 (= V598) to G: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; does not alter thermodynamic stability; dbSNP:rs200055428
- G637 (≠ A602) to E: in MMAM; mut-; to R: in MMAM; mut0; dbSNP:rs781501004
- F638 (= F603) to I: in MMAM; mut0
- D640 (= D605) to Y: in MMAM; mut0; dbSNP:rs865815395
- G642 (= G607) to R: in MMAM; mut-; dbSNP:rs747897332
- G648 (= G613) to D: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; strong decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs766721811
- V669 (= V634) to E: in MMAM; mut0; dbSNP:rs1360470463
- I671 (= I636) to V: in dbSNP:rs8589
- L674 (≠ Q639) to F: in MMAM; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs1164271240
- H678 (= H643) to R: in MMAM; mut-; dbSNP:rs147094927
- E684 (≠ Q649) natural variant: E -> EL (in MMAM; mut-)
- L685 (= L650) to R: in MMAM; mut-; dbSNP:rs864309739
- R694 (≠ A659) to L: in MMAM; mut-; decreased protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; to W: in MMAM; mut- and mut0; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs777758903
- M700 (≠ I665) to K: in MMAM; mut-; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs140600746
- G703 (= G668) to R: in MMAM; mut0; dbSNP:rs121918255
- G717 (= G682) to V: in MMAM; mut-; no effect on protein abundance; interferes with the binding of the cofactor to the apoenzyme; decreased methylmalonyl-CoA mutase activity; strong decreased affinity for adenosylcob(III)alamin; decreased thermodynamic stability; dbSNP:rs121918252
- G723 (= G688) to D: in MMAM; decreased protein expression; decreased methylmalonyl-CoA mutase activity; dbSNP:rs755077681
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 7:750 natural variant: Missing (in MMAM; mut-)
- 152:750 natural variant: Missing (in MMAM; mut0)
- 228:750 natural variant: Missing (in MMAM; mut0)
2xiqA Crystal structure of human methylmalonyl-coa mutase in complex with adenosylcobalamin and malonyl-coa (see paper)
64% identity, 99% coverage: 7:707/707 of query aligns to 7:707/714 of 2xiqA
- active site: Y75 (= Y77), Y229 (= Y231), H230 (= H232), K586 (= K586), D590 (= D590), H592 (= H592)
- binding cobalamin: Y75 (= Y77), L105 (= L107), H108 (= H110), A125 (= A127), R193 (= R195), E233 (= E235), G320 (= G321), W321 (≠ V322), E357 (= E358), G360 (≠ A361), L361 (= L362), G591 (= G591), H592 (= H592), D593 (= D593), R594 (= R594), G595 (= G595), I599 (= I599), G635 (= G635), S637 (= S637), L639 (≠ Q639), A641 (= A641), G667 (= G667), G668 (= G668), F687 (= F687), G688 (= G688), T691 (= T691)
- binding malonyl-coenzyme a: Y61 (≠ K63), T63 (= T65), M64 (= M66), R68 (= R70), T71 (= T73), R73 (= R75), Y75 (= Y77), S150 (= S152), T152 (= T154), T181 (= T183), R193 (= R195), K220 (= K222), H230 (= H232), R269 (= R271), S271 (= S273), F273 (= F275), R313 (= R314), A314 (≠ T315), H315 (= H316), Q317 (= Q318), Q348 (= Q349)
8dyjB Crystal structure of human methylmalonyl-coa mutase in complex with adp and cob(ii)alamin (see paper)
64% identity, 99% coverage: 7:707/707 of query aligns to 6:706/708 of 8dyjB
- binding adenosine-5'-diphosphate: Y74 (= Y77), T151 (= T154), R192 (= R195), Y228 (= Y231), H229 (= H232), F272 (= F275), Q316 (= Q318), N352 (= N354), E356 (= E358), L360 (= L362), P361 (= P363)
- binding cobalamin: F102 (= F105), L104 (= L107), H107 (= H110), A124 (= A127), V191 (= V194), R192 (= R195), H229 (= H232), E232 (= E235), G319 (= G321), W320 (≠ V322), E356 (= E358), G359 (≠ A361), L360 (= L362), G590 (= G591), H591 (= H592), D592 (= D593), R593 (= R594), G594 (= G595), I598 (= I599), S636 (= S637), L638 (≠ Q639), A640 (= A641), G666 (= G667), G667 (= G668), V668 (= V669), F686 (= F687), G687 (= G688), T690 (= T691)
8gjuJ Crystal structure of human methylmalonyl-coa mutase (mmut) in complex with methylmalonic acidemia type a protein (mmaa), coenzyme a, and gdp (see paper)
63% identity, 99% coverage: 7:707/707 of query aligns to 7:684/689 of 8gjuJ
- binding coenzyme a: Y61 (≠ K63), T63 (= T65), R68 (= R70), T71 (= T73), R73 (= R75), S150 (= S152), T152 (= T154), T181 (= T183), Q183 (= Q185), N222 (= N224), R269 (= R271), S271 (= S273), R313 (= R314), A314 (≠ T315), H315 (= H316), Q348 (= Q349)
6oxdA Structure of mycobacterium tuberculosis methylmalonyl-coa mutase with adenosyl cobalamin (see paper)
65% identity, 96% coverage: 24:701/707 of query aligns to 43:725/736 of 6oxdA
- active site: Y100 (= Y77), Y254 (= Y231), H255 (= H232), K610 (= K586), D614 (= D590), H616 (= H592)
- binding cobalamin: Y100 (= Y77), L130 (= L107), H133 (= H110), A150 (= A127), R218 (= R195), E258 (= E235), G344 (= G321), W345 (≠ V322), E381 (= E358), A382 (= A359), A384 (= A361), L385 (= L362), G615 (= G591), H616 (= H592), D617 (= D593), R618 (= R594), S661 (= S637), L663 (≠ Q639), A665 (= A641), G691 (= G667), G692 (= G668), F711 (= F687), P712 (≠ G688), T715 (= T691)
- binding Itaconyl coenzyme A: Y86 (≠ K63), T88 (= T65), M89 (= M66), Q93 (≠ R70), T96 (= T73), R98 (= R75), Y100 (= Y77), S175 (= S152), T177 (= T154), T206 (= T183), R218 (= R195), H255 (= H232), R294 (= R271), S296 (= S273), F298 (= F275), R337 (= R314), T338 (= T315), H339 (= H316), Q341 (= Q318), Q372 (= Q349)
4reqA Methylmalonyl-coa mutase substrate complex (see paper)
62% identity, 96% coverage: 26:707/707 of query aligns to 36:723/726 of 4reqA
- active site: Y87 (= Y77), Y241 (= Y231), H242 (= H232), K602 (= K586), D606 (= D590), H608 (= H592)
- binding cobalamin: Y87 (= Y77), L117 (= L107), A137 (= A127), V204 (= V194), R205 (= R195), H242 (= H232), E245 (= E235), G331 (= G321), W332 (≠ V322), E368 (= E358), A369 (= A359), A371 (= A361), L372 (= L362), G607 (= G591), H608 (= H592), D609 (= D593), R610 (= R594), G611 (= G595), I615 (= I599), S653 (= S637), L655 (≠ Q639), G683 (= G667), G684 (= G668), V685 (= V669), Y703 (≠ F687), T704 (≠ G688), T707 (= T691)
- binding methylmalonyl-coenzyme a: Y73 (≠ K63), M76 (= M66), F79 (≠ G69), R80 (= R70), T83 (= T73), R85 (= R75), Y87 (= Y77), S112 (= S102), S162 (= S152), T164 (= T154), T193 (= T183), R205 (= R195), N234 (= N224), Y241 (= Y231), H242 (= H232), R281 (= R271), S283 (= S273), F285 (= F275), H326 (= H316), Q328 (= Q318), Q359 (= Q349), S360 (= S350)
- binding succinyl-coenzyme a: Y73 (≠ K63), M76 (= M66), F79 (≠ G69), R80 (= R70), T83 (= T73), R85 (= R75), Y87 (= Y77), S162 (= S152), T164 (= T154), T193 (= T183), Q195 (= Q185), R205 (= R195), N234 (= N224), Y241 (= Y231), H242 (= H232), R281 (= R271), S283 (= S273), F285 (= F275), R324 (= R314), H326 (= H316), Q359 (= Q349)
7reqA Methylmalonyl-coa mutase, 2-carboxypropyl-coa inhibitor complex (see paper)
62% identity, 96% coverage: 26:707/707 of query aligns to 35:722/725 of 7reqA
- active site: Y86 (= Y77), Y240 (= Y231), H241 (= H232), K601 (= K586), D605 (= D590), H607 (= H592)
- binding 2-carboxypropyl-coenzyme a: Y72 (≠ K63), T74 (= T65), M75 (= M66), F78 (≠ G69), R79 (= R70), T82 (= T73), R84 (= R75), Y86 (= Y77), S161 (= S152), T163 (= T154), T192 (= T183), R204 (= R195), H241 (= H232), R280 (= R271), S282 (= S273), F284 (= F275), H325 (= H316), Q358 (= Q349)
- binding cobalamin: Y86 (= Y77), L116 (= L107), A136 (= A127), R204 (= R195), E244 (= E235), G330 (= G321), W331 (≠ V322), E367 (= E358), A368 (= A359), A370 (= A361), G606 (= G591), H607 (= H592), D608 (= D593), R609 (= R594), G610 (= G595), I614 (= I599), S652 (= S637), L654 (≠ Q639), G682 (= G667), G683 (= G668), Y702 (≠ F687), T703 (≠ G688), T706 (= T691)
3reqA Methylmalonyl-coa mutase, substrate-free state (poor quality structure) (see paper)
62% identity, 96% coverage: 26:707/707 of query aligns to 35:722/725 of 3reqA
- active site: Y86 (= Y77), Y240 (= Y231), H241 (= H232), K601 (= K586), D605 (= D590), H607 (= H592)
- binding adenosine: Y86 (= Y77), Y240 (= Y231), E244 (= E235), G330 (= G321)
- binding cobalamin: L116 (= L107), V203 (= V194), R204 (= R195), E244 (= E235), G330 (= G321), W331 (≠ V322), A368 (= A359), G606 (= G591), H607 (= H592), D608 (= D593), R609 (= R594), G610 (= G595), I614 (= I599), G650 (= G635), S652 (= S637), L654 (≠ Q639), G682 (= G667), G683 (= G668), Y702 (≠ F687), T703 (≠ G688), P704 (= P689), T706 (= T691)
2reqA Methylmalonyl-coa mutase, non-productive coa complex, in open conformation representing substrate-free state (see paper)
62% identity, 96% coverage: 26:707/707 of query aligns to 35:722/725 of 2reqA
- active site: Y86 (= Y77), Y240 (= Y231), H241 (= H232), K601 (= K586), D605 (= D590), H607 (= H592)
- binding cobalamin: V203 (= V194), R204 (= R195), E244 (= E235), A245 (= A236), W331 (≠ V322), A368 (= A359), G606 (= G591), H607 (= H592), D608 (= D593), R609 (= R594), G610 (= G595), I614 (= I599), G650 (= G635), S652 (= S637), L654 (≠ Q639), A655 (= A640), G682 (= G667), G683 (= G668), Y702 (≠ F687), T703 (≠ G688), T706 (= T691)
- binding coenzyme a: Y72 (≠ K63), R79 (= R70), K318 (≠ R309)
6reqA Methylmalonyl-coa mutase, 3-carboxypropyl-coa inhibitor complex (see paper)
62% identity, 96% coverage: 26:707/707 of query aligns to 37:724/727 of 6reqA
- active site: Y88 (= Y77), Y242 (= Y231), H243 (= H232), K603 (= K586), D607 (= D590), H609 (= H592)
- binding 3-carboxypropyl-coenzyme a: Y74 (≠ K63), T76 (= T65), M77 (= M66), F80 (≠ G69), R81 (= R70), T84 (= T73), R86 (= R75), Y88 (= Y77), S113 (= S102), S163 (= S152), T165 (= T154), T194 (= T183), R206 (= R195), H243 (= H232), R282 (= R271), S284 (= S273), F286 (= F275), H327 (= H316), Q329 (= Q318), Q360 (= Q349)
- binding cobalamin: Y88 (= Y77), F116 (= F105), L118 (= L107), H121 (= H110), A138 (= A127), R206 (= R195), E246 (= E235), G332 (= G321), W333 (≠ V322), E369 (= E358), A370 (= A359), A372 (= A361), G608 (= G591), H609 (= H592), D610 (= D593), R611 (= R594), G612 (= G595), I616 (= I599), Y620 (≠ F603), S654 (= S637), L656 (≠ Q639), G658 (≠ A641), G684 (= G667), G685 (= G668), Y704 (≠ F687), T705 (≠ G688), T708 (= T691)
P11653 Methylmalonyl-CoA mutase large subunit; MCM-alpha; EC 5.4.99.2 from Propionibacterium freudenreichii subsp. shermanii (see 4 papers)
62% identity, 96% coverage: 26:707/707 of query aligns to 38:725/728 of P11653
- Y75 (≠ K63) binding
- M78 (= M66) binding
- R82 (= R70) binding
- T85 (= T73) binding
- R87 (= R75) binding
- Y89 (= Y77) binding ; mutation to F: Does not significantly affect affinity for succiny-CoA, but kcat is lowered about 580-fold.
- S114 (= S102) binding
- F117 (= F105) binding
- A139 (= A127) binding
- T195 (= T183) binding
- Q197 (= Q185) binding
- V206 (= V194) binding
- R207 (= R195) binding ; binding
- H244 (= H232) binding
- R283 (= R271) binding
- S285 (= S273) binding
- G333 (= G321) binding
- E370 (= E358) binding
- A373 (= A361) binding
- G609 (= G591) binding
- H610 (= H592) binding axial binding residue
- D611 (= D593) binding
- R612 (= R594) binding
- S655 (= S637) binding
- L657 (≠ Q639) binding
- G686 (= G668) binding
- T709 (= T691) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5reqA Methylmalonyl-coa mutase, y89f mutant, substrate complex (see paper)
62% identity, 96% coverage: 26:707/707 of query aligns to 35:722/725 of 5reqA
- active site: F86 (≠ Y77), Y240 (= Y231), H241 (= H232), K601 (= K586), D605 (= D590), H607 (= H592)
- binding cobalamin: L116 (= L107), A136 (= A127), R204 (= R195), H241 (= H232), E244 (= E235), G330 (= G321), W331 (≠ V322), E367 (= E358), A368 (= A359), A370 (= A361), G606 (= G591), H607 (= H592), D608 (= D593), R609 (= R594), G610 (= G595), I614 (= I599), S652 (= S637), L654 (≠ Q639), G682 (= G667), G683 (= G668), V684 (= V669), Y702 (≠ F687), T703 (≠ G688), T706 (= T691)
- binding methylmalonyl(carbadethia)-coenzyme a: Y72 (≠ K63), T74 (= T65), M75 (= M66), R79 (= R70), T82 (= T73), R84 (= R75), F86 (≠ Y77), S111 (= S102), S161 (= S152), T163 (= T154), T192 (= T183), Q194 (= Q185), R204 (= R195), N233 (= N224), H241 (= H232), R280 (= R271), S282 (= S273), F284 (= F275), T324 (= T315), H325 (= H316), Q358 (= Q349), S359 (= S350)
- binding succinyl(carbadethia)-coenzyme a: Y72 (≠ K63), T74 (= T65), M75 (= M66), R79 (= R70), T82 (= T73), R84 (= R75), F86 (≠ Y77), S161 (= S152), T163 (= T154), T192 (= T183), R204 (= R195), N233 (= N224), H241 (= H232), R280 (= R271), S282 (= S273), F284 (= F275), H325 (= H316), Q358 (= Q349)
1e1cA Methylmalonyl-coa mutase h244a mutant (see paper)
62% identity, 96% coverage: 26:707/707 of query aligns to 37:724/727 of 1e1cA
- active site: Y88 (= Y77), Y242 (= Y231), A243 (≠ H232), K603 (= K586), D607 (= D590), H609 (= H592)
- binding cobalamin: Y88 (= Y77), L118 (= L107), H121 (= H110), A138 (= A127), V205 (= V194), R206 (= R195), E246 (= E235), G332 (= G321), W333 (≠ V322), E369 (= E358), A370 (= A359), A372 (= A361), L373 (= L362), G608 (= G591), H609 (= H592), D610 (= D593), R611 (= R594), G612 (= G595), I616 (= I599), Y620 (≠ F603), S654 (= S637), L656 (≠ Q639), G684 (= G667), G685 (= G668), V686 (= V669), Y704 (≠ F687), T705 (≠ G688), T708 (= T691), S713 (≠ A696)
- binding desulfo-coenzyme a: Y74 (≠ K63), M77 (= M66), F80 (≠ G69), R81 (= R70), T84 (= T73), R86 (= R75), S113 (= S102), S163 (= S152), T165 (= T154), T194 (= T183), R282 (= R271), S284 (= S273), H327 (= H316), Q360 (= Q349)
4r3uA Crystal structure of 2-hydroxyisobutyryl-coa mutase (see paper)
43% identity, 77% coverage: 16:557/707 of query aligns to 27:557/557 of 4r3uA
- active site: I89 (≠ Y77), Y243 (= Y231), H244 (= H232)
- binding 3-hydroxybutanoyl-coenzyme a: Y75 (≠ K63), T77 (= T65), M78 (= M66), R82 (= R70), T85 (= T73), R87 (= R75), I89 (≠ Y77), D116 (≠ A104), S164 (= S152), T166 (= T154), T195 (= T183), Q197 (= Q185), R234 (≠ K222), N236 (= N224), N239 (≠ S227), Y243 (= Y231), H244 (= H232), R283 (= R271), F287 (= F275), R327 (= R314), F328 (≠ T315), H329 (= H316), Q331 (= Q318), Q362 (= Q349)
- binding S-{(3R,5R,9R)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9-trihydroxy-8,8-dimethyl-3,5-dioxido-10,14-dioxo-2,4,6-trioxa-11,15-diaza-3lambda~5~,5lambda~5~-diphosphaheptadecan-17-yl} 2-hydroxy-2-methylpropanethioate: Y75 (≠ K63), T77 (= T65), M78 (= M66), R82 (= R70), T85 (= T73), R87 (= R75), I89 (≠ Y77), D116 (≠ A104), S164 (= S152), T166 (= T154), T195 (= T183), Q197 (= Q185), R234 (≠ K222), N236 (= N224), N239 (≠ S227), H244 (= H232), R283 (= R271), F287 (= F275), R327 (= R314), F328 (≠ T315), H329 (= H316), Q331 (= Q318), Q362 (= Q349)
- binding cobalamin: D116 (≠ A104), M119 (≠ L107), E139 (≠ A127), Q207 (≠ R195), E209 (≠ T197), E247 (= E235), A334 (≠ G321), E371 (= E358), A372 (= A359), A374 (= A361)
I3VE77 2-hydroxyisobutanoyl-CoA mutase large subunit; 2-hydroxyisobutyryl-CoA mutase large subunit; HCM large subunit; EC 5.4.99.64 from Aquincola tertiaricarbonis (see 2 papers)
43% identity, 77% coverage: 16:557/707 of query aligns to 28:558/562 of I3VE77
- YPTM 76:79 (≠ KATM 63:66) binding
- TMR 86:88 (≠ TIR 73:75) binding
- I90 (≠ Y77) mutation to A: 6-fold decrease in catalytic efficiency with 2-hydroxyisobutyryl-CoA as substrate. 320-fold decrease in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. 6-fold increase in catalytic efficiency with (R)-3-hydroxybutyryl-CoA as substrate. No change in catalytic efficiencies with pivalyl-CoA and isovaleryl-CoA as substrates.; mutation I->F,Y: Loss of activity.; mutation to L: 37-fold decrease in catalytic efficiency with 2-hydroxyisobutyryl-CoA as substrate. 290-fold decrease in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. Does not show any significant activities with pivalyl-CoA and isovaleryl-CoA.; mutation to V: 100-fold decrease in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. No change in catalytic efficiencies with pivalyl-CoA and isovaleryl-CoA as substrates.
- D117 (≠ A104) binding ; mutation to A: 2-fold increase in catalytic efficiency with 2-hydroxyisobutyryl-CoA as substrate. Small increase in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. 1800-fold increase in catalytic efficiency with (R)-3-hydroxybutyryl-CoA as substrate.; mutation to V: 1.5-fold increase in catalytic efficiency with 2-hydroxyisobutyryl-CoA as substrate. 3-fold decrease in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. 1300-fold increase in catalytic efficiency with (R)-3-hydroxybutyryl-CoA as substrate. 74-fold increase in catalytic efficiency with pivalyl-CoA as substrate.
- TVQ 196:198 (≠ TIQ 183:185) binding
- R235 (≠ K222) binding
- N240 (≠ S227) binding
- H245 (= H232) binding
- R284 (= R271) binding
4xc7A Isobutyryl-coa mutase fused with bound butyryl-coa and without cobalamin or gdp (apo-icmf) (see paper)
37% identity, 68% coverage: 51:534/707 of query aligns to 541:1042/1053 of 4xc7A
- active site: F566 (≠ Y77), Y747 (= Y231), H748 (= H232)
- binding Butyryl Coenzyme A: F553 (≠ K63), R557 (≠ Y67), R564 (= R75), F566 (≠ Y77), R590 (vs. gap), S645 (= S152), T647 (= T154), R696 (≠ A181), T698 (= T183), Y740 (≠ N224), S789 (= S273), F791 (= F275), R824 (= R309), K829 (≠ R314), H831 (= H316)
Sites not aligning to the query:
5cjtA Isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate isobutyryl-coenzyme a (see paper)
37% identity, 68% coverage: 51:534/707 of query aligns to 544:1051/1062 of 5cjtA
- active site: F569 (≠ Y77), Y750 (= Y231), H751 (= H232)
- binding cobalamin: F598 (= F105), L603 (≠ H110), S621 (≠ A127), Q713 (≠ R195), H751 (= H232), E754 (= E235), A755 (= A236), G839 (= G321), R840 (≠ V322), E876 (= E358), A877 (= A359), T879 (≠ A361), H964 (≠ D446)
- binding isobutyryl-coenzyme a: F556 (≠ K63), F558 (≠ T65), R560 (≠ Y67), R567 (= R75), F569 (≠ Y77), R593 (vs. gap), S648 (= S152), T650 (= T154), R699 (≠ A181), T701 (= T183), Q703 (= Q185), Y743 (≠ N224), Y750 (= Y231), H751 (= H232), S792 (= S273), F794 (= F275), R827 (= R309), K832 (≠ R314), H834 (= H316)
- binding guanosine-5'-diphosphate: E944 (≠ A426)
Sites not aligning to the query:
- active site: 6
- binding cobalamin: 18, 19, 20, 21, 22, 26, 66, 67, 94, 96, 98, 116, 117
- binding guanosine-5'-diphosphate: 199, 201, 202, 203, 204, 245, 336, 337, 339, 374, 376
- binding magnesium ion: 203, 229, 242, 242, 289, 289
5cjwA Isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate pivalyl-coenzyme a (see paper)
37% identity, 68% coverage: 51:534/707 of query aligns to 546:1052/1063 of 5cjwA
- active site: F571 (≠ Y77), Y752 (= Y231), H753 (= H232)
- binding pivalyl-coenzyme A: F558 (≠ K63), F560 (≠ T65), R562 (≠ Y67), R569 (= R75), F571 (≠ Y77), R595 (vs. gap), S650 (= S152), T652 (= T154), R701 (≠ A181), T703 (= T183), Q705 (= Q185), Y745 (≠ N224), Y752 (= Y231), H753 (= H232), S794 (= S273), F796 (= F275), R829 (= R309), K834 (≠ R314), H836 (= H316)
- binding cobalamin: F600 (= F105), L605 (≠ H110), S623 (≠ A127), Q715 (≠ R195), H753 (= H232), E756 (= E235), A757 (= A236), G841 (= G321), R842 (≠ V322), E878 (= E358), A879 (= A359), T881 (≠ A361), H966 (≠ D446)
Sites not aligning to the query:
- active site: 6
- binding cobalamin: 18, 19, 20, 21, 22, 26, 66, 67, 94, 96, 98, 116, 117, 118
- binding guanosine-5'-diphosphate: 199, 201, 202, 203, 204, 245, 337, 338, 340, 375, 377, 1062
- binding magnesium ion: 203, 229, 242, 242, 290, 290
5cjvA Isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate isovaleryl-coenzyme a (see paper)
37% identity, 68% coverage: 51:534/707 of query aligns to 544:1050/1061 of 5cjvA
- active site: F569 (≠ Y77), Y750 (= Y231), H751 (= H232)
- binding cobalamin: F598 (= F105), L603 (≠ H110), S621 (≠ A127), Q713 (≠ R195), E754 (= E235), A755 (= A236), G839 (= G321), R840 (≠ V322), E876 (= E358), A877 (= A359), T879 (≠ A361), H964 (≠ D446)
- binding guanosine-5'-diphosphate: E944 (≠ A426)
- binding Isovaleryl-coenzyme A: F556 (≠ K63), F558 (≠ T65), R560 (≠ Y67), R567 (= R75), F569 (≠ Y77), R593 (vs. gap), S648 (= S152), T650 (= T154), R699 (≠ A181), T701 (= T183), Q703 (= Q185), Q713 (≠ R195), Y743 (≠ N224), H751 (= H232), S792 (= S273), F794 (= F275), K832 (≠ R314), H834 (= H316)
Sites not aligning to the query:
- active site: 6
- binding cobalamin: 18, 19, 20, 21, 22, 26, 66, 67, 94, 96, 98, 116, 117, 129
- binding guanosine-5'-diphosphate: 199, 201, 202, 203, 204, 245, 336, 338, 373, 375
- binding magnesium ion: 203, 229, 242, 242, 288, 288
4xc6A Isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, and mg (holo-icmf/gdp) (see paper)
37% identity, 68% coverage: 51:534/707 of query aligns to 547:1056/1067 of 4xc6A
- active site: F572 (≠ Y77), Y753 (= Y231), H754 (= H232)
- binding cobalamin: F601 (= F105), L606 (≠ H110), S624 (≠ A127), Q716 (≠ R195), H754 (= H232), E757 (= E235), A758 (= A236), G842 (= G321), R843 (≠ V322), E879 (= E358), A880 (= A359), T882 (≠ A361), H967 (≠ D446)
- binding guanosine-5'-diphosphate: E947 (≠ A426)
Sites not aligning to the query:
- active site: 6
- binding cobalamin: 18, 19, 20, 21, 22, 26, 66, 67, 94, 96, 98, 116, 117, 118, 129
- binding guanosine-5'-diphosphate: 199, 201, 202, 203, 204, 245, 337, 338, 340, 375, 377
- binding magnesium ion: 203, 229, 242, 242, 290, 290
Query Sequence
>GFF2118 PGA1_c21510 methylmalonyl-CoA mutase BhbA
MTTKTDDWRALAEKELRGRPLDALTWNTLEGIDVKPLYTEADTKDLPHMGTMPGFGPFTR
GVKATMYAGRPWTIRQYAGFSTAEESNAFYRRNLAAGQQGVSVAFDLATHRGYDSDHPRV
MGDVGKAGVAIDSVEDMKILFDGIPLDQVSVSMTMNGAVIPILASFIVAGEEQGHDKSLL
AGTIQNDILKEFMVRNTYIYPPEPSMRIISDIIEYTSNEMPKFNSISISGYHMQEAGANL
VQELAYTLADGREYVRAAMEAGMDVDKFAGRLSFFFAIGMNFFMEIAKLRAARTLWHRVM
TDFDAKNDRSKMLRTHCQTSGVSLQEQDPYNNVIRTAYEAMSAVLGGTQSLHTNALDEAI
ALPTDFSARIARNTQLVLQEETGVTNVVDPLAGSYYVESLTNELIEKAWALMEEVEEMGG
MTKAVASGMPKLRIEESAARRQAMIDRGEEVIVGVNKYRKEKEDPIDILDVDNVAVRDSQ
IARLETLRADRDSAACEAALDNLTRVAKEGGNLLAAAVEAARARASVGEISMAMEKEFGR
HSAEVKTLAGVYGAAYEGDEGFAAIQKSIEDFAEAEGRRPRLLVVKMGQDGHDRGAKVIA
TAFADIGFDVDVGPLFQTPDEAAQDAIDNDVHVVGISSQAAGHKTLAPQLVKALKEQGAE
DIIVICGGVIPQQDYQFLYDNGVKAIFGPGTNIPEAAQDILKLIRQS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory