SitesBLAST
Comparing GFF2134 FitnessBrowser__WCS417:GFF2134 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
29% identity, 92% coverage: 56:733/739 of query aligns to 20:718/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (≠ G74), G39 (= G75), Q40 (= Q76), H41 (≠ G77), V42 (≠ T78), A45 (= A81), G79 (= G119), G80 (= G120), S81 (= S121), S83 (= S123), V84 (= V124), G374 (≠ F411), F375 (= F412), L379 (≠ F416), L499 (≠ W529), R500 (= R530), V624 (= V639), D625 (≠ N640), Q632 (= Q647), T687 (≠ G702), G688 (= G703), L689 (≠ I704), G690 (= G705), E691 (= E706)
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
23% identity, 49% coverage: 201:561/739 of query aligns to 5:382/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
23% identity, 49% coverage: 201:561/739 of query aligns to 4:381/420 of 3hrdE
- active site: Q207 (= Q381), L242 (≠ F416), R318 (≠ P497), H322 (≠ E501), R350 (= R530)
- binding calcium ion: T206 (≠ N380), N208 (≠ A382), D212 (≠ F386), K241 (≠ H415), L242 (≠ F416), D243 (≠ S420)
- binding pterin cytosine dinucleotide: G237 (≠ F411), F238 (= F412), R350 (= R530)
- binding selenium atom: F238 (= F412), A348 (≠ Y528), F349 (≠ W529), R350 (= R530)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
23% identity, 49% coverage: 201:561/739 of query aligns to 4:381/420 of 3hrdA
- active site: Q207 (= Q381), L242 (≠ F416), R318 (≠ P497), H322 (≠ E501), R350 (= R530)
- binding pterin cytosine dinucleotide: G236 (= G410), G237 (≠ F411), F238 (= F412), R350 (= R530)
- binding magnesium ion: T206 (≠ N380), N208 (≠ A382), D212 (≠ F386), K241 (≠ H415), L242 (≠ F416), D243 (≠ S420), T305 (= T484), Y308 (≠ L487), A309 (= A488), S346 (≠ L526)
- binding nicotinic acid: A314 (≠ D493), R318 (≠ P497), F352 (≠ V532)
- binding selenium atom: F238 (= F412), G239 (= G413), A348 (≠ Y528), F349 (≠ W529), R350 (= R530)
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
33% identity, 20% coverage: 586:734/739 of query aligns to 587:746/761 of 1rm6A
- active site: E718 (= E706), G719 (≠ P707)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): L646 (≠ V639), N647 (= N640), V651 (= V644), Q654 (= Q647), K714 (vs. gap), E715 (vs. gap), A716 (vs. gap), S717 (vs. gap), E718 (= E706)
Sites not aligning to the query:
- active site: 206, 241, 318, 322, 350
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 235, 236, 237, 238, 350, 473, 474, 475, 476, 513, 514, 515, 517, 518
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
33% identity, 20% coverage: 586:734/739 of query aligns to 595:754/769 of O33819
- VGKALN 650:655 (≠ PGSIVN 635:640) binding
- KEAS 722:725 (vs. gap) binding
Sites not aligning to the query:
- 214 binding
- 244:245 binding
- 522:526 binding
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
24% identity, 50% coverage: 203:574/739 of query aligns to 2:376/701 of 4zohA
Sites not aligning to the query:
- active site: 668, 669
- binding pterin cytosine dinucleotide: 442, 443, 444, 446, 482, 484, 486, 487, 594, 595, 598, 602, 664, 665, 666, 667, 668
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
24% identity, 42% coverage: 274:587/739 of query aligns to 110:401/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
26% identity, 49% coverage: 200:561/739 of query aligns to 14:381/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
26% identity, 49% coverage: 200:561/739 of query aligns to 14:381/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
1ffvB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
26% identity, 46% coverage: 219:560/739 of query aligns to 27:409/797 of 1ffvB
- active site: Q231 (= Q381), V266 (≠ F416), P343 (≠ E501), I349 (≠ L503), R378 (≠ W529), C379 (≠ R530)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G260 (= G410), G261 (≠ F411), F262 (= F412), G263 (= G413), A376 (≠ G527), R378 (≠ W529), C379 (≠ R530)
Sites not aligning to the query:
- active site: 751, 752
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 516, 517, 518, 520, 523, 556, 557, 558, 560, 561, 674, 678, 683, 686, 747, 748, 749, 750, 751
1ffuB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
26% identity, 46% coverage: 219:560/739 of query aligns to 27:409/797 of 1ffuB
Sites not aligning to the query:
- active site: 751, 752
- binding cytidine-5'-diphosphate: 518, 520, 523, 558, 560, 561, 674, 676, 678, 683, 747, 748, 749, 750
P19913 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Hydrogenophaga pseudoflava (Pseudomonas carboxydoflava) (see paper)
26% identity, 46% coverage: 219:560/739 of query aligns to 33:415/803 of P19913
- R384 (≠ W529) modified: 4-hydroxyarginine
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
24% identity, 54% coverage: 166:566/739 of query aligns to 133:572/906 of 1dgjA
Sites not aligning to the query:
- active site: 869, 870
- binding molybdenum (iv)oxide: 698, 869
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 41, 43, 44, 45, 46, 48, 58, 60, 100, 101, 103
- binding pterin cytosine dinucleotide: 99, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
22% identity, 49% coverage: 202:560/739 of query aligns to 12:401/786 of 1t3qB
Sites not aligning to the query:
- active site: 743, 744
- binding pterin cytosine dinucleotide: 506, 507, 508, 510, 513, 545, 547, 549, 550, 666, 670, 674, 675, 678, 739, 740, 741, 742
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
24% identity, 53% coverage: 166:560/739 of query aligns to 133:563/907 of 4usaA
- active site: I390 (≠ Q381), F425 (= F416), R501 (≠ T498), F505 (≠ L503), R533 (≠ L526)
- binding bicarbonate ion: R460 (= R454), A531 (≠ P524), F532 (≠ M525), Y535 (= Y528), Q539 (≠ L536)
- binding fe2/s2 (inorganic) cluster: C137 (≠ G170), C139 (≠ S172)
- binding hydrocinnamic acid: I255 (≠ V272), F425 (= F416), F494 (≠ L487), L497 (≠ K494), Y535 (= Y528)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C139 (≠ S172), T420 (≠ F411), F421 (= F412), G422 (= G413), R533 (≠ L526)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103
- binding hydrocinnamic acid: 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
24% identity, 53% coverage: 166:560/739 of query aligns to 133:563/907 of 4us9A
- active site: I390 (≠ Q381), F425 (= F416), R501 (≠ T498), F505 (≠ L503), R533 (≠ L526)
- binding 3-phenylpropanal: I255 (≠ V272), F257 (vs. gap), P258 (vs. gap)
- binding bicarbonate ion: R460 (= R454), L498 (≠ I495), A531 (≠ P524), F532 (≠ M525), Y535 (= Y528), Q539 (≠ L536)
- binding fe2/s2 (inorganic) cluster: C137 (≠ G170), C139 (≠ S172)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C139 (≠ S172), T420 (≠ F411), F421 (= F412), G422 (= G413), R533 (≠ L526)
Sites not aligning to the query:
- active site: 869, 870
- binding 3-phenylpropanal: 752
- binding bicarbonate ion: 890, 892
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
24% identity, 53% coverage: 166:560/739 of query aligns to 133:563/907 of 4us8A
- active site: I390 (≠ Q381), F425 (= F416), R501 (≠ T498), F505 (≠ L503), R533 (≠ L526)
- binding bicarbonate ion: R460 (= R454), L498 (≠ I495), A531 (≠ P524), F532 (≠ M525), Y535 (= Y528), Q539 (≠ L536)
- binding fe2/s2 (inorganic) cluster: C137 (≠ G170), C139 (≠ S172)
- binding benzaldehyde: I255 (≠ V272), I255 (≠ V272), L394 (≠ M385), F425 (= F416), F425 (= F416), F425 (= F416), F425 (= F416), L497 (≠ K494), L497 (≠ K494), R501 (≠ T498), A531 (≠ P524), Y535 (= Y528), Y535 (= Y528)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C139 (≠ S172), T420 (≠ F411), F421 (= F412), G422 (= G413), R533 (≠ L526)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103
- binding benzaldehyde: 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
24% identity, 53% coverage: 166:560/739 of query aligns to 133:563/907 of 4c7yA
- active site: I390 (≠ Q381), F425 (= F416), R501 (≠ T498), F505 (≠ L503), R533 (≠ L526)
- binding bicarbonate ion: R460 (= R454), L498 (≠ I495), A531 (≠ P524), Y535 (= Y528), Q539 (≠ L536)
- binding fe2/s2 (inorganic) cluster: C137 (≠ G170), C139 (≠ S172)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C139 (≠ S172), T420 (≠ F411), F421 (= F412), G422 (= G413), R533 (≠ L526)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
24% identity, 53% coverage: 166:560/739 of query aligns to 133:563/907 of 3fc4A
- active site: I390 (≠ Q381), F425 (= F416), R501 (≠ T498), F505 (≠ L503), R533 (≠ L526)
- binding 1,2-ethanediol: Y535 (= Y528)
- binding fe2/s2 (inorganic) cluster: C137 (≠ G170), C139 (≠ S172)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C139 (≠ S172), G419 (= G410), T420 (≠ F411), F421 (= F412), G422 (= G413), R533 (≠ L526)
Sites not aligning to the query:
- active site: 869, 870
- binding 1,2-ethanediol: 622, 696, 697, 869
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Query Sequence
>GFF2134 FitnessBrowser__WCS417:GFF2134
MNLINELLDAPVNLSRRRFLASTAVGALVIGFGLPLGAGRVQAATSAERGTQVPAFLEIR
PDGTVRLLSPFMEGGQGTHTAMAQIVGEELDADPATFIVEAAPPGEAYVVMENGLRITGG
SMSVRMSYPTMRRLGALARAMLLQAGAKQWGVPVGELTTQPGRVVHAASGRSLGYGELAS
SALDMPVPDPASITLRDPSQFRWIGKPVKRLDAYDKSTGKALYSIDLKVDNMLHAAVQHA
PRLGMTVGSLRNQSQVEGMKGVHSVHVLPGAVAVVAERWWHAKRAVEAIQVDWQEAAADS
ALRVMPADFSSDKHREFLAAQQGPTRDDENEGDVAGALKGAKTQVEATYHNQYLNHAQLE
PPSALARFNPDGTLEIWLPNQAPDMFRADIAKRTGLDPAQITLHSPLLGGFFGRHFLYDS
ANPYPQAIALAKAVSRPIKLIWSREEEFLRDVLRPLAVVKFRAALDDKGLPVAIEAVSAT
EGPTEALAGKQGDKIDPTAVEGLSGKSYAIPNKRIAQIYVKGAPMLGYWRSVGNSLNDFF
YESFLDELADKGGHDPYELRLHLLRDNPRLTTLLQAAGELSGGWKRGPFTAEDGTRRARG
VAMASPFGSHTAAIAEVSIENGKVKVHDIWQAIDPGSIVNPAIVEAQVNGAVALGLSQTL
LEEAVYVDGKPRARNYDLYPILAPAQMARVHVRVVESGEKMGGIGEPPLPAVAPAVANAV
AQLTGQRVRSLPLSRHTFS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory