Comparing GFF2141 FitnessBrowser__Marino:GFF2141 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cvqA Crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution (see paper)
66% identity, 100% coverage: 1:404/404 of query aligns to 1:404/404 of 4cvqA
P0A959 Glutamate-pyruvate aminotransferase AlaA; EC 2.6.1.2 from Escherichia coli (strain K12) (see paper)
66% identity, 100% coverage: 1:404/404 of query aligns to 1:404/405 of P0A959
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
42% identity, 98% coverage: 7:401/404 of query aligns to 3:392/393 of 1xi9C
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
30% identity, 91% coverage: 35:401/404 of query aligns to 27:384/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
30% identity, 91% coverage: 35:401/404 of query aligns to 27:384/388 of 1gd9A
1j32A Aspartate aminotransferase from phormidium lapideum
28% identity, 97% coverage: 7:399/404 of query aligns to 4:384/388 of 1j32A
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
29% identity, 94% coverage: 20:398/404 of query aligns to 18:395/400 of Q02635
Sites not aligning to the query:
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
29% identity, 94% coverage: 20:398/404 of query aligns to 17:394/399 of 6f77A
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
30% identity, 93% coverage: 20:395/404 of query aligns to 16:392/399 of 5wmhA
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
30% identity, 93% coverage: 20:395/404 of query aligns to 17:393/404 of 5wmlA
Sites not aligning to the query:
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
30% identity, 90% coverage: 31:395/404 of query aligns to 27:392/402 of 5wmiA
Sites not aligning to the query:
Q93703 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Caenorhabditis elegans (see 3 papers)
28% identity, 90% coverage: 34:398/404 of query aligns to 75:437/464 of Q93703
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
28% identity, 92% coverage: 25:396/404 of query aligns to 33:403/410 of P58350
3tcmA Crystal structure of alanine aminotransferase from hordeum vulgare (see paper)
26% identity, 95% coverage: 15:398/404 of query aligns to 17:470/479 of 3tcmA
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
28% identity, 92% coverage: 25:396/404 of query aligns to 23:393/400 of 6f35A
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
25% identity, 93% coverage: 25:401/404 of query aligns to 26:397/402 of P14909
Sites not aligning to the query:
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
27% identity, 93% coverage: 24:399/404 of query aligns to 28:382/384 of 1o4sB
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
28% identity, 94% coverage: 24:401/404 of query aligns to 22:384/385 of Q56232
Sites not aligning to the query:
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
28% identity, 93% coverage: 24:399/404 of query aligns to 22:382/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
28% identity, 93% coverage: 24:399/404 of query aligns to 22:382/382 of 1gc4A
>GFF2141 FitnessBrowser__Marino:GFF2141
MQNYYKSAKLDNVCYEIRGVVLREARRLEEEGHRVLKLNIGNPAAFELDVPEEIQQDVIY
NMHQAQGYVESKGLFSARKAVMHYCQQRGIDKVDIDDIFLGNGVSELIVMTMQAMLNTGD
EVLIPAPDYPLWTAAVTLSSGKPVHYRCDEQQDWFPDIDDIRKKITRRTRAIVLINPNNP
TGAVYSKELLEQVIELARKHNLIILSDEIYDKILYDGTQHISTASLADDVLFFTYNGLSK
NYRAAGYRSGWMIVSGAKHRAKDLIEGIDMLSNMRLCANVPAQLAIQTALGGYQSINDLV
APGGRLYEQRETAWRMLNDIPGVSCVKPQGALYLFPKLDPKHFPIVNDEKLVLDLLLQEK
ILLVQGSAFNIDDRQHLRVVFLPREDTLEDAMGRLGNFLGQYQQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory