SitesBLAST
Comparing GFF2144 FitnessBrowser__Marino:GFF2144 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2o4cA Crystal structure of d-erythronate-4-phosphate dehydrogenase complexed with NAD (see paper)
51% identity, 99% coverage: 1:381/383 of query aligns to 1:379/380 of 2o4cA
- active site: N91 (= N91), R208 (= R209), D232 (= D233), E237 (= E238), H254 (= H255)
- binding nicotinamide-adenine-dinucleotide: N91 (= N91), V95 (= V95), G123 (= G124), G125 (= G126), Q126 (≠ N127), V127 (= V128), D146 (= D147), P147 (= P148), P148 (= P149), H174 (= H175), T175 (= T176), P176 (= P177), H183 (= H184), T185 (= T186), A206 (= A207), S207 (≠ G208), H254 (= H255), A256 (= A257), G257 (= G258)
- binding phosphate ion: T66 (= T66), R346 (= R347)
Q9I3W9 Erythronate-4-phosphate dehydrogenase; EC 1.1.1.290 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
51% identity, 99% coverage: 1:381/383 of query aligns to 1:379/380 of Q9I3W9
- C65 (≠ T65) modified: Disulfide link with 90
- C90 (= C90) modified: Disulfide link with 65
- QV 126:127 (≠ NV 127:128) binding
- D146 (= D147) binding
- T175 (= T176) binding
- ASR 206:208 (≠ AGR 207:209) binding
- D232 (= D233) binding
- G257 (= G258) binding
3oetH D-erythronate-4-phosphate dehydrogenase complexed with NAD
46% identity, 95% coverage: 1:362/383 of query aligns to 3:357/378 of 3oetH
- active site: N93 (= N91), R210 (= R209), D234 (= D233), E237 (= E236), E239 (= E238), G253 (≠ A252), H256 (= H255)
- binding nicotinamide-adenine-dinucleotide: N93 (= N91), V97 (= V95), G125 (= G124), G127 (= G126), N128 (= N127), V129 (= V128), D148 (= D147), P149 (= P148), P150 (= P149), H176 (= H175), T177 (= T176), P178 (= P177), Y185 (≠ H184), T187 (= T186), A208 (= A207), C209 (≠ G208), H256 (= H255), A258 (= A257)
5dt9A Crystal structure of a putative d-erythronate-4-phosphate dehydrogenase from vibrio cholerae
42% identity, 100% coverage: 1:383/383 of query aligns to 4:378/379 of 5dt9A
- active site: N95 (= N91), R212 (= R209), D236 (= D233), E241 (= E238), H258 (= H255)
- binding nicotinamide-adenine-dinucleotide: N95 (= N91), G129 (= G126), Q130 (≠ N127), V131 (= V128), D150 (= D147), K153 (≠ R150), H178 (= H175), T179 (= T176), P180 (= P177), W187 (≠ H184), T189 (= T186), A210 (= A207), A211 (≠ G208), H258 (= H255), A260 (= A257), G261 (= G258)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
29% identity, 64% coverage: 33:278/383 of query aligns to 41:311/334 of 5aovA
- active site: L100 (≠ N91), R241 (= R209), D265 (= D233), E270 (= E238), H288 (= H255)
- binding glyoxylic acid: M52 (≠ R44), L53 (≠ S45), L53 (≠ S45), Y74 (≠ T65), A75 (≠ T66), V76 (≠ I67), G77 (= G68), R241 (= R209), H288 (= H255)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ I67), T104 (≠ V95), F158 (≠ V125), G159 (= G126), R160 (≠ N127), I161 (≠ V128), S180 (≠ P149), R181 (= R150), A211 (≠ H175), V212 (≠ T176), P213 (= P177), T218 (= T186), I239 (≠ A207), A240 (≠ G208), R241 (= R209), H288 (= H255), G290 (≠ A257)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
26% identity, 76% coverage: 4:295/383 of query aligns to 8:334/334 of 3kb6B
- active site: S97 (≠ N91), R231 (= R209), D255 (= D233), E260 (= E238), H294 (= H255)
- binding lactic acid: F49 (≠ R44), S72 (≠ T66), V73 (≠ I67), G74 (= G68), Y96 (≠ C90), R231 (= R209), H294 (= H255)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ I67), Y96 (≠ C90), V101 (= V95), G150 (= G126), R151 (≠ N127), I152 (≠ V128), D171 (= D147), V172 (vs. gap), P203 (= P177), T229 (≠ A207), A230 (≠ G208), R231 (= R209), H294 (= H255), A296 (= A257), Y297 (≠ G258)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
31% identity, 61% coverage: 33:264/383 of query aligns to 37:287/304 of 1wwkA
- active site: S96 (≠ N91), R230 (= R209), D254 (= D233), E259 (= E238), H278 (= H255)
- binding nicotinamide-adenine-dinucleotide: V100 (= V95), G146 (vs. gap), F147 (vs. gap), G148 (vs. gap), R149 (vs. gap), I150 (vs. gap), Y168 (≠ C146), D169 (= D147), P170 (= P148), V201 (≠ T176), P202 (= P177), T207 (= T186), T228 (≠ A207), S229 (≠ G208), D254 (= D233), H278 (= H255), G280 (≠ A257)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
29% identity, 66% coverage: 28:278/383 of query aligns to 35:310/332 of 6biiA
- active site: L99 (≠ N91), R240 (= R209), D264 (= D233), E269 (= E238), H287 (= H255)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ I67), T103 (≠ V95), G156 (= G124), F157 (≠ V125), G158 (= G126), R159 (≠ N127), I160 (≠ V128), A179 (≠ P149), R180 (= R150), S181 (≠ A151), K183 (≠ R153), V211 (≠ T176), P212 (= P177), E216 (= E181), T217 (= T186), V238 (≠ A207), A239 (≠ G208), R240 (= R209), D264 (= D233), H287 (= H255), G289 (≠ A257)
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 66% coverage: 29:279/383 of query aligns to 85:368/466 of P87228
- S87 (= S31) modified: Phosphoserine
- S258 (≠ T179) modified: Phosphoserine
2eklA Structure of st1218 protein from sulfolobus tokodaii
27% identity, 62% coverage: 37:275/383 of query aligns to 45:302/312 of 2eklA
- active site: S100 (≠ N91), R232 (= R209), D256 (= D233), E261 (≠ Q237), H282 (= H255)
- binding nicotinamide-adenine-dinucleotide: I76 (= I67), S100 (≠ N91), G148 (= G124), G150 (= G126), R151 (≠ N127), I152 (≠ V128), Y170 (≠ C146), D171 (= D147), I172 (vs. gap), L173 (vs. gap), H202 (= H175), V203 (≠ T176), T204 (≠ P177), I212 (≠ M189), T230 (≠ A207), S231 (≠ G208), D256 (= D233), G284 (≠ A257)
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
31% identity, 61% coverage: 33:264/383 of query aligns to 45:297/406 of 2p9eA
- active site: N104 (= N91), R236 (= R209), D260 (= D233), E265 (= E238), H288 (= H255)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G156 (= G126), H157 (≠ N127), I158 (≠ V128), Y176 (≠ C146), D177 (= D147), I178 (≠ P148), H206 (= H175), V207 (≠ T176), P208 (= P177), S212 (vs. gap), A234 (= A207), S235 (≠ G208), R236 (= R209), H288 (= H255), G290 (≠ A257)
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
31% identity, 61% coverage: 33:264/383 of query aligns to 45:297/406 of 1ybaA
- active site: N104 (= N91), R236 (= R209), D260 (= D233), E265 (= E238), H288 (= H255)
- binding 2-oxoglutaric acid: R56 (= R44), S57 (= S45), C79 (≠ T66), I80 (= I67)
- binding nicotinamide-adenine-dinucleotide: I80 (= I67), F102 (≠ G89), V108 (= V95), G154 (= G124), G156 (= G126), H157 (≠ N127), I158 (≠ V128), Y176 (≠ C146), D177 (= D147), I178 (≠ P148), K181 (≠ A151), H206 (= H175), V207 (≠ T176), P208 (= P177), A234 (= A207), S235 (≠ G208), R236 (= R209), H288 (= H255), G290 (≠ A257)
- binding phosphate ion: G81 (= G68), N83 (≠ D70)
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 61% coverage: 33:264/383 of query aligns to 49:301/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
31% identity, 61% coverage: 33:264/383 of query aligns to 43:295/404 of 1psdA
- active site: N102 (= N91), R234 (= R209), D258 (= D233), E263 (= E238), H286 (= H255)
- binding nicotinamide-adenine-dinucleotide: N102 (= N91), H155 (≠ N127), I156 (≠ V128), D175 (= D147), I176 (≠ P148), K179 (≠ A151), H204 (= H175), V205 (≠ T176), P206 (= P177), A232 (= A207), S233 (≠ G208), R234 (= R209), H286 (= H255)
Sites not aligning to the query:
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
28% identity, 77% coverage: 1:293/383 of query aligns to 3:308/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
28% identity, 77% coverage: 1:293/383 of query aligns to 4:309/525 of 3ddnB
P17584 D-2-hydroxyisocaproate dehydrogenase; D-HICDH; EC 1.1.1.- from Lacticaseibacillus paracasei (Lactobacillus paracasei) (see paper)
26% identity, 64% coverage: 52:295/383 of query aligns to 62:332/333 of P17584
1dxyA Structure of d-2-hydroxyisocaproate dehydrogenase (see paper)
27% identity, 60% coverage: 52:279/383 of query aligns to 62:316/330 of 1dxyA
- active site: S101 (≠ N91), R234 (= R209), D258 (= D233), E263 (= E238), H295 (= H255)
- binding 2-oxo-4-methylpentanoic acid: V77 (≠ I67), Y100 (≠ C90), Y298 (≠ G258)
- binding nicotinamide-adenine-dinucleotide: Y100 (≠ C90), G152 (= G124), G154 (= G126), H155 (≠ N127), I156 (≠ V128), Y174 (≠ C146), D175 (= D147), P176 (= P148), H204 (= H175), V205 (≠ T176), P206 (= P177), N211 (≠ T186), T232 (≠ A207), A233 (≠ G208), R234 (= R209), H295 (= H255), Y298 (≠ G258)
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
27% identity, 69% coverage: 16:278/383 of query aligns to 28:311/333 of 2dbqA
- active site: L100 (≠ N91), R241 (= R209), D265 (= D233), E270 (= E238), H288 (= H255)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ I67), T104 (≠ V95), L158 (vs. gap), G159 (vs. gap), R160 (vs. gap), I161 (vs. gap), S180 (≠ P149), R181 (= R150), T182 (≠ A151), A211 (≠ H175), V212 (≠ T176), P213 (= P177), T218 (= T186), I239 (≠ A207), A240 (≠ G208), R241 (= R209), D265 (= D233), H288 (= H255), G290 (≠ A257)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
27% identity, 69% coverage: 16:278/383 of query aligns to 28:311/334 of O58320
Query Sequence
>GFF2144 FitnessBrowser__Marino:GFF2144
MLIVADENIPLLDSFFGDIGEIRRVSGRSMSNEDVRDADIVLVRSVTRVNRELLEGSRVR
FVGTTTIGTDHVDLDWLEAAGIRFSAAPGCNANSVAEYVLSVLSLHAERRGLADWSQLSV
GIVGVGNVGGELAHKLERLGFDVRLCDPPRADREEEDQEFVSLEEAMKCDVVSLHTPLTR
EGDHPTLHMIGHPELEALGANQLLINAGRGEVIDSSALLARLDQGNAPTVALDVWEQEPR
IHPELVDRVWLATPHIAGYSLEGKVQGTEMIYQALSQFLGLPVRKKAGQFLPEPALSKIS
FTSSADEDDAIRIALRACYDPRPDDARLRNAMTGSVEERGAAFDRLRRDYPVRRECSSLK
IQLKGTSKSLQDSFRAIGFKLKI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory