Comparing GFF2154 FitnessBrowser__Phaeo:GFF2154 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 97% coverage: 1:243/250 of query aligns to 93:340/346 of Q6NPM8
5eq9B Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol phosphate and mg2+ (see paper)
42% identity, 98% coverage: 2:247/250 of query aligns to 14:259/260 of 5eq9B
5eq8A Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol (see paper)
42% identity, 98% coverage: 2:247/250 of query aligns to 13:258/259 of 5eq8A
5t3jA Histidinol phosphate phosphatase(hpp) soaked with selenourea for 10 min (see paper)
41% identity, 98% coverage: 2:247/250 of query aligns to 16:256/257 of 5t3jA
Sites not aligning to the query:
Q9K4B1 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
34% identity, 94% coverage: 13:248/250 of query aligns to 26:264/266 of Q9K4B1
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 93% coverage: 1:232/250 of query aligns to 12:244/260 of P95189
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
34% identity, 93% coverage: 1:232/250 of query aligns to 10:242/256 of 5zonA
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
34% identity, 93% coverage: 1:232/250 of query aligns to 9:241/255 of 5yhtA
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 87% coverage: 29:245/250 of query aligns to 42:268/271 of Q9M8S8
Q19420 Inositol monophosphatase ttx-7; IMP; IMPase; Abnormal thermotaxis protein 7; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase; EC 3.1.3.25; EC 3.1.3.94 from Caenorhabditis elegans (see paper)
30% identity, 90% coverage: 14:238/250 of query aligns to 29:268/285 of Q19420
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
32% identity, 79% coverage: 25:221/250 of query aligns to 21:211/238 of 3luzA
Sites not aligning to the query:
2p3nA Thermotoga maritima impase tm1415 (see paper)
26% identity, 84% coverage: 29:239/250 of query aligns to 36:239/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
26% identity, 84% coverage: 29:239/250 of query aligns to 36:239/256 of O33832
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
31% identity, 77% coverage: 29:221/250 of query aligns to 37:229/258 of 3lv0A
P9WKI9 Inositol-1-monophosphatase SuhB; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 69% coverage: 29:201/250 of query aligns to 54:235/290 of P9WKI9
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
31% identity, 77% coverage: 29:221/250 of query aligns to 38:232/267 of P0ADG4
Sites not aligning to the query:
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
31% identity, 77% coverage: 29:221/250 of query aligns to 42:236/270 of 6ib8B
6tqoT Rrn anti-termination complex (see paper)
31% identity, 77% coverage: 29:221/250 of query aligns to 30:224/255 of 6tqoT
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
31% identity, 77% coverage: 29:221/250 of query aligns to 38:232/262 of 2qflA
3luzB Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
31% identity, 77% coverage: 29:221/250 of query aligns to 26:207/234 of 3luzB
Sites not aligning to the query:
>GFF2154 FitnessBrowser__Phaeo:GFF2154
MADAARQAILPYFRSAGLQSDNKLDEGFDPVTIADRAAEQAMRSVLSELRPEDSILGEEF
GETHGQSGRTWVLDPIDGTRGFISGTPTWGVLIALGDADGPFLGIVDQPYIGERFIGTPE
GASLTGPLGHSALVTRATDSLSEATLFTTFPEVGTEAERAAFQRVSAQVRLTRYGMDCYA
YALLAAGQCDLVIEAGLNAYDIQAPIAVIQAAGGVVTNWQGEPAHEGGQVLAAATAELHA
AALALIQQTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory