Comparing GFF2159 FitnessBrowser__WCS417:GFF2159 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1eyyA Crystal structure of the NADP+ dependent aldehyde dehydrogenase from vibrio harveyi. (see paper)
45% identity, 94% coverage: 24:519/526 of query aligns to 7:501/504 of 1eyyA
6wsbA Crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei bound to cofactor NAD (see paper)
30% identity, 76% coverage: 9:406/526 of query aligns to 9:402/489 of 6wsbA
Sites not aligning to the query:
5ekcE Thermostable aldehyde dehydrogenase from pyrobaculum sp.1860 complexed with NADP+
25% identity, 76% coverage: 8:406/526 of query aligns to 10:398/490 of 5ekcE
Sites not aligning to the query:
5ek6A Thermostable aldehyde dehydrogenase from pyrobaculum sp. 1860 complexed with NADP and isobutyraldehyde (see paper)
25% identity, 76% coverage: 8:406/526 of query aligns to 3:391/482 of 5ek6A
Sites not aligning to the query:
4h73A Thermostable aldehyde dehydrogenase from pyrobaculum sp. Complexed with NADP+
25% identity, 76% coverage: 8:406/526 of query aligns to 3:391/482 of 4h73A
Sites not aligning to the query:
2d4eC Crystal structure of the hpcc from thermus thermophilus hb8
26% identity, 81% coverage: 43:468/526 of query aligns to 64:490/515 of 2d4eC
Q59931 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Glyceraldehyde-3-phosphate dehydrogenase [NADP(+)]; Non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase; Triosephosphate dehydrogenase; EC 1.2.1.9 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see 3 papers)
28% identity, 75% coverage: 7:402/526 of query aligns to 6:388/475 of Q59931
Sites not aligning to the query:
2esdA Crystal structure of thioacylenzyme intermediate of an NADP dependent aldehyde dehydrogenase (see paper)
28% identity, 75% coverage: 7:402/526 of query aligns to 5:387/474 of 2esdA
Sites not aligning to the query:
Q9H2A2 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 from Homo sapiens (Human) (see paper)
26% identity, 79% coverage: 7:423/526 of query aligns to 11:423/487 of Q9H2A2
Sites not aligning to the query:
1qi1B Ternary complex of an NADP dependent aldehyde dehydrogenase (see paper)
28% identity, 69% coverage: 41:402/526 of query aligns to 37:387/474 of 1qi1B
Sites not aligning to the query:
3ju8A Crystal structure of succinylglutamic semialdehyde dehydrogenase from pseudomonas aeruginosa.
31% identity, 57% coverage: 4:302/526 of query aligns to 1:280/486 of 3ju8A
Sites not aligning to the query:
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
27% identity, 76% coverage: 9:408/526 of query aligns to 8:402/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
27% identity, 76% coverage: 9:408/526 of query aligns to 8:402/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
27% identity, 76% coverage: 9:408/526 of query aligns to 8:402/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
27% identity, 76% coverage: 9:408/526 of query aligns to 8:402/488 of 8vqwC
8vj3A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (fad bound)
27% identity, 76% coverage: 9:408/526 of query aligns to 8:402/488 of 8vj3A
8uzoA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (adp bound)
27% identity, 76% coverage: 9:408/526 of query aligns to 8:402/488 of 8uzoA
8uznA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (amp bound)
27% identity, 76% coverage: 9:408/526 of query aligns to 8:402/488 of 8uznA
8uzmA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADPH bound)
27% identity, 76% coverage: 9:408/526 of query aligns to 8:402/488 of 8uzmA
8uzkA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADP+ bound)
27% identity, 76% coverage: 9:408/526 of query aligns to 8:402/488 of 8uzkA
>GFF2159 FitnessBrowser__WCS417:GFF2159
MTSFLGHNYIGGQRSANGSVTLQSVDATSGEALPQHFYQATPQEVDAAAKAAAQAYPAYR
ALSAARRAQFLDAVADELDALGDEFVELVCRETALPAARIKGERGRTSGQMRLFATVLRR
GDFYGARIDKALPDRQPMPRPDLRQYRIGLGPVAVFGASNFPLAFSTAGGDTAAALAAGC
PVVFKAHSGHMATAERVADAIIRAAEATEMPAGVFNMIFGGGVGEALVKHPAIQAVGFTG
SLKGGRALCDMAAARPQPIPVFAEMSSINPVIVLPQALKARAESVARDLTASVVQGCGQF
CTNPGLVIGVASPEFTAFTQQVAQLIGDQPAQTMLNAGTLSSYGKGLEKLLAHPGIQHLA
GSQQAGNQAQPQLFKADVRLLIDGDEVLQEEVFGPTTVFVEVADQAQLSAALHGLHGQLT
ATIIGEPADLQQFAELTPLLEQKVGRILLNGYPTGVEVCDSMVHGGPYPATSDARGTSVG
TLAIDRFLRPVCFQNYPDSLLPDALKNANPLRIQRLVDGTPSRDPL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory