SitesBLAST
Comparing GFF2165 PS417_11045 3-oxoacyl-ACP reductase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5wjsA Crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh
55% identity, 99% coverage: 2:254/255 of query aligns to 5:257/258 of 5wjsA
- active site: G27 (= G24), S152 (= S149), Y162 (= Y159), Y165 (= Y162), K169 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G23 (= G20), T26 (≠ S23), I28 (= I25), D47 (= D44), L48 (≠ R45), D73 (= D70), L74 (≠ I71), N100 (= N97), A102 (= A99), L150 (= L147), G151 (= G148), S152 (= S149), K169 (= K166), P195 (= P192), G196 (= G193), W197 (= W194), V198 (= V195), K202 (= K199)
7wwxA Crystal structure of herbaspirillum huttiense l-arabinose 1- dehydrogenase (NAD bound form) (see paper)
52% identity, 99% coverage: 4:255/255 of query aligns to 2:254/254 of 7wwxA
- binding nicotinamide-adenine-dinucleotide: G18 (= G20), T21 (≠ S23), I23 (= I25), D42 (= D44), I43 (≠ R45), C68 (= C69), D69 (= D70), L70 (≠ I71), N96 (= N97), A98 (= A99), F146 (≠ L147), S147 (≠ G148), S148 (= S149), Y161 (= Y162), K165 (= K166), P191 (= P192), G192 (= G193), W193 (= W194), V194 (= V195), R198 (≠ K199)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
38% identity, 96% coverage: 11:255/255 of query aligns to 4:238/244 of 1nfqA
- active site: G17 (= G24), S139 (= S149), Y152 (= Y162), K156 (= K166)
- binding Androsterone: L91 (≠ D101), E141 (≠ G151), C149 (≠ Y159), Y152 (= Y162), V193 (= V205), I197 (≠ A208), F198 (≠ A209)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ S23), G17 (= G24), M18 (≠ I25), D37 (= D44), L39 (≠ A46), L59 (≠ C69), D60 (= D70), V61 (≠ I71), N87 (= N97), A88 (= A98), I137 (≠ L147), S139 (= S149), Y152 (= Y162), K156 (= K166), P182 (= P192), V185 (= V195), T187 (= T197), P188 (≠ Q200), M189 (≠ L201), T190 (≠ A202)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
38% identity, 96% coverage: 11:255/255 of query aligns to 4:238/244 of 1nffA
- active site: G17 (= G24), S139 (= S149), Y152 (= Y162), K156 (= K166)
- binding nicotinamide-adenine-dinucleotide: G13 (= G20), R16 (≠ S23), G17 (= G24), M18 (≠ I25), D37 (= D44), I38 (≠ R45), L39 (≠ A46), L59 (≠ C69), D60 (= D70), V61 (≠ I71), N87 (= N97), A88 (= A98), G89 (≠ A99), I90 (≠ N100), I137 (≠ L147), S139 (= S149), Y152 (= Y162), K156 (= K166), P182 (= P192), V185 (= V195), T187 (= T197), P188 (≠ Q200), M189 (≠ L201), T190 (≠ A202)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 96% coverage: 10:254/255 of query aligns to 4:252/255 of 5itvA
- active site: G18 (= G24), S141 (= S149), Y154 (= Y162), K158 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G20), S17 (= S23), G18 (= G24), I19 (= I25), D38 (= D44), I39 (≠ R45), T61 (≠ C69), I63 (= I71), N89 (= N97), G91 (≠ A99), T139 (≠ L147), S141 (= S149), Y154 (= Y162), K158 (= K166), P184 (= P192), G185 (= G193), I186 (≠ W194), I187 (≠ V195)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
34% identity, 96% coverage: 11:254/255 of query aligns to 4:257/260 of 6zzqA
- active site: G17 (= G24), S142 (= S149), Y155 (= Y162)
- binding acetoacetic acid: Q94 (≠ D101), S142 (= S149), K152 (≠ Y159), Y155 (= Y162), Q196 (≠ M203)
- binding nicotinamide-adenine-dinucleotide: G13 (= G20), S16 (= S23), G17 (= G24), I18 (= I25), D37 (= D44), M38 (≠ R45), D63 (= D70), V64 (≠ I71), N90 (= N97), A91 (= A98), G92 (≠ A99), M140 (≠ L147), A141 (≠ G148), S142 (= S149), Y155 (= Y162), K159 (= K166), Y187 (≠ W194), V188 (= V195), T190 (= T197)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
34% identity, 96% coverage: 11:254/255 of query aligns to 5:258/261 of 6zzsD
- active site: G18 (= G24), S143 (= S149), Y156 (= Y162)
- binding nicotinamide-adenine-dinucleotide: G14 (= G20), S17 (= S23), I19 (= I25), D38 (= D44), M39 (≠ R45), D64 (= D70), V65 (≠ I71), N91 (= N97), A92 (= A98), G93 (≠ A99), M141 (≠ L147), A142 (≠ G148), S143 (= S149), Y156 (= Y162), K160 (= K166), P186 (= P192), G187 (= G193), V189 (= V195), T191 (= T197), L193 (≠ K199)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ D101), S143 (= S149), N145 (≠ G151), K153 (≠ Y159), Y156 (= Y162), Q197 (≠ M203)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
35% identity, 96% coverage: 11:254/255 of query aligns to 2:257/260 of 2ztlA
- active site: G15 (= G24), N114 (= N121), S142 (= S149), Y155 (= Y162), K159 (= K166), L200 (≠ W204)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ D101), S142 (= S149), H144 (≠ G151), K152 (≠ Y159), Y155 (= Y162), Q196 (= Q200)
- binding nicotinamide-adenine-dinucleotide: G11 (= G20), G15 (= G24), I16 (= I25), F36 (= F42), L64 (≠ I71), N90 (= N97), A91 (= A98), G92 (≠ A99), L113 (≠ V120), Y155 (= Y162), K159 (= K166), P185 (= P192), W187 (= W194), V188 (= V195), T190 (= T197), V193 (vs. gap)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
35% identity, 96% coverage: 11:254/255 of query aligns to 2:257/260 of 1wmbA
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 96% coverage: 11:255/255 of query aligns to 5:239/260 of P9WGT1
- I6 (≠ E12) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ SGI 23:25) binding
- D38 (= D44) binding
- V47 (≠ L53) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (≠ DI 70:71) binding
- T69 (≠ K78) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (= N97) binding
- S140 (= S149) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y162) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K166) binding
- 183:191 (vs. 192:202, 36% identical) binding
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
36% identity, 96% coverage: 11:255/255 of query aligns to 3:246/247 of 4jroC
- active site: G16 (= G24), S142 (= S149), Q152 (≠ Y159), Y155 (= Y162), K159 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (≠ A22), R15 (≠ S23), G16 (= G24), I17 (= I25), N35 (vs. gap), Y36 (≠ V43), N37 (≠ D44), G38 (≠ R45), S39 (≠ A46), N63 (= N68), V64 (≠ C69), N90 (= N97), A91 (= A98), I93 (≠ N100), I113 (≠ V120), S142 (= S149), Y155 (= Y162), K159 (= K166), P185 (= P192), I188 (≠ V195), T190 (= T197)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
35% identity, 96% coverage: 11:255/255 of query aligns to 3:242/244 of 7krmC
- active site: G18 (= G24), S140 (= S149), Y155 (= Y162)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), S15 (= S23), G18 (= G24), I19 (= I25), D38 (= D44), L39 (≠ R45), A60 (≠ C69), N61 (≠ D70), V62 (≠ I71), N88 (= N97), V111 (= V120), S140 (= S149), Y155 (= Y162), K159 (= K166), I188 (≠ V195), T190 (= T197)
1x1tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with NAD+ (see paper)
34% identity, 96% coverage: 11:254/255 of query aligns to 2:233/236 of 1x1tA
- active site: G15 (= G24), N114 (= N121), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding cacodylate ion: S142 (= S149), H144 (≠ G151), Y155 (= Y162), W187 (= W194), W233 (= W254)
- binding nicotinamide-adenine-dinucleotide: G11 (= G20), T13 (≠ A22), S14 (= S23), G15 (= G24), I16 (= I25), G35 (= G41), F36 (= F42), D63 (= D70), L64 (≠ I71), N90 (= N97), G92 (≠ A99), L113 (≠ V120), S142 (= S149), Y155 (= Y162), K159 (= K166), P185 (= P192), W187 (= W194), V188 (= V195), T190 (= T197)
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
33% identity, 96% coverage: 11:255/255 of query aligns to 4:249/251 of 1zk1A
- active site: G17 (= G24), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding 1-phenylethanone: A93 (≠ D101), N95 (≠ R103), Y155 (= Y162), Y189 (≠ W194)
- binding nicotinamide-adenine-dinucleotide: G13 (= G20), L16 (≠ S23), I18 (= I25), D37 (= D44), H61 (≠ C69), D62 (= D70), S63 (≠ I71), N89 (= N97), A90 (= A98), I92 (≠ N100), M140 (≠ L147), Y155 (= Y162), G188 (= G193), I190 (≠ V195), L194 (≠ W204)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
33% identity, 96% coverage: 11:255/255 of query aligns to 4:249/251 of 1zjzA
- active site: G17 (= G24), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding nicotinamide-adenine-dinucleotide: G13 (= G20), L16 (≠ S23), I18 (= I25), D37 (= D44), D62 (= D70), N89 (= N97), A90 (= A98), G91 (≠ A99), I92 (≠ N100), Y155 (= Y162), G188 (= G193), I190 (≠ V195), L194 (≠ W204)
- binding (1r)-1-phenylethanol: A93 (≠ D101), N95 (≠ R103), L152 (≠ Y159), Y155 (= Y162)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
33% identity, 96% coverage: 11:255/255 of query aligns to 4:249/251 of 1zjyA
- active site: G17 (= G24), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G20), L16 (≠ S23), G17 (= G24), I18 (= I25), D37 (= D44), D62 (= D70), N89 (= N97), A90 (= A98), G91 (≠ A99), I92 (≠ N100), Y155 (= Y162), G188 (= G193), I190 (≠ V195), L194 (≠ W204)
- binding (1r)-1-phenylethanol: A93 (≠ D101), N95 (≠ R103), L152 (≠ Y159), Y155 (= Y162), Y189 (≠ W194)
F1SWA0 Zerumbone synthase; EC 1.1.1.326 from Zingiber zerumbet (Shampoo ginger) (Amomum zerumbet) (see paper)
32% identity, 96% coverage: 11:254/255 of query aligns to 3:256/267 of F1SWA0
- S142 (= S149) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- S144 (≠ G151) mutation to A: Increased oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- Y155 (= Y162) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- K159 (= K166) mutation to A: Abolishes all oxidoreductase activity.
6y0sAAA R-specific alcohol dehydrogenase (see paper)
33% identity, 96% coverage: 11:255/255 of query aligns to 4:249/251 of 6y0sAAA
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
33% identity, 96% coverage: 11:255/255 of query aligns to 2:258/260 of 5b4tA
- active site: G15 (= G24), N114 (= N121), S142 (= S149), Y155 (= Y162), K159 (= K166), I200 (vs. gap)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ D101), S142 (= S149), H144 (≠ G151), K152 (≠ Y159), Y155 (= Y162), W187 (= W194), Q196 (= Q200)
- binding nicotinamide-adenine-dinucleotide: G11 (= G20), T13 (≠ A22), G15 (= G24), I16 (= I25), F36 (= F42), D63 (= D70), L64 (≠ I71), N90 (= N97), G92 (≠ A99), L113 (≠ V120), I140 (≠ L147), Y155 (= Y162), K159 (= K166), P185 (= P192), G186 (= G193), W187 (= W194), V188 (= V195), T190 (= T197), L192 (vs. gap), V193 (vs. gap)
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
33% identity, 96% coverage: 11:255/255 of query aligns to 2:258/260 of 3w8dA
- active site: G15 (= G24), N114 (= N121), S142 (= S149), Y155 (= Y162), K159 (= K166), I200 (vs. gap)
- binding methylmalonic acid: Q94 (≠ D101), S142 (= S149), H144 (≠ G151), K152 (≠ Y159), Y155 (= Y162), W187 (= W194), Q196 (= Q200), W257 (= W254)
- binding nicotinamide-adenine-dinucleotide: G11 (= G20), T13 (≠ A22), S14 (= S23), G15 (= G24), I16 (= I25), F36 (= F42), A62 (≠ C69), D63 (= D70), L64 (≠ I71), N90 (= N97), A91 (= A98), G92 (≠ A99), L113 (≠ V120), S142 (= S149), Y155 (= Y162), K159 (= K166), P185 (= P192), G186 (= G193), W187 (= W194), V188 (= V195), T190 (= T197), L192 (vs. gap), V193 (vs. gap)
Query Sequence
>GFF2165 PS417_11045 3-oxoacyl-ACP reductase
MNTQHAVYPDLEGKTVLISGGASGIGEFMVRAFAAQGAKVGFVDRAQSQGERLAALLSSR
GHTVEFVNCDITDEIAYKAAIGRFEHSLGPISVLVNNAANDARHTLEEVDSEMFDRLIAV
NLKHAFFAAKAVVPMMKSAGGGAIINLGSVGWMMASAGYPVYAASKAAAHGMTRALAREL
GPSRIRVNTLVPGWVMTEKQLAMWVDDAAKELISRSQCLPGSVLPEHIANMALFLASDAS
AMCSAQNFIVDGGWV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory