SitesBLAST
Comparing GFF2172 FitnessBrowser__WCS417:GFF2172 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
31% identity, 99% coverage: 6:334/334 of query aligns to 5:340/342 of 3ceaA
- active site: K98 (= K99), H185 (= H179)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), G13 (= G14), R14 (= R15), L15 (≠ M16), L38 (≠ P39), Q42 (= Q43), V74 (≠ A75), A75 (= A76), P76 (= P77), T77 (≠ A78), F79 (≠ S80), H80 (= H81), M83 (≠ L84), E97 (= E98), K98 (= K99), M127 (≠ N127), F169 (≠ L161), H185 (= H179), F286 (≠ D275)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
29% identity, 99% coverage: 6:334/334 of query aligns to 3:338/340 of 4n54A
- active site: K96 (= K99), H183 (= H179)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (= R15), K96 (= K99), D156 (= D158), D179 (≠ E175), M180 (≠ T176), H183 (= H179), R238 (≠ F235), Y244 (= Y241)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ I11), G9 (= G12), L10 (≠ A13), G11 (= G14), R12 (= R15), L13 (≠ M16), S35 (≠ D38), V36 (≠ P39), E40 (≠ Q43), S73 (≠ A76), P74 (= P77), F77 (≠ S80), H78 (= H81), E95 (= E98), K96 (= K99), M125 (≠ N127), F167 (≠ L161), F284 (≠ D280)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
27% identity, 97% coverage: 6:329/334 of query aligns to 3:321/336 of 3ec7A
- active site: K97 (= K99), H176 (= H179)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), M12 (≠ R15), I13 (≠ M16), D35 (= D38), I36 (≠ P39), R40 (≠ Q43), T73 (≠ A75), A74 (= A76), S75 (≠ P77), N76 (≠ A78), H79 (= H81), E96 (= E98), K97 (= K99), M126 (≠ N127), W271 (vs. gap), Y279 (= Y288)
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
28% identity, 98% coverage: 5:330/334 of query aligns to 2:323/337 of 3nt5A
- active site: K97 (= K99), H176 (= H179)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K99), H155 (≠ T156), H176 (= H179), Y235 (= Y241)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), G11 (= G14), A12 (≠ R15), I13 (≠ M16), D35 (= D38), V36 (≠ P39), S74 (≠ A76), W75 (≠ P77), G76 (≠ A78), E96 (= E98), K97 (= K99), Y280 (= Y288)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
28% identity, 98% coverage: 5:330/334 of query aligns to 2:323/337 of 3nt4A
- active site: K97 (= K99), H176 (= H179)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ T156), H176 (= H179), Y235 (= Y241), W272 (vs. gap)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G14), A12 (≠ R15), I13 (≠ M16), D35 (= D38), V36 (≠ P39), S74 (≠ A76), W75 (≠ P77), G76 (≠ A78), E96 (= E98), K97 (= K99), H176 (= H179)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
28% identity, 98% coverage: 5:330/334 of query aligns to 2:323/337 of 3nt2B
- active site: K97 (= K99), H176 (= H179)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G12), G11 (= G14), A12 (≠ R15), D35 (= D38), V36 (≠ P39), S74 (≠ A76), W75 (≠ P77), A78 (≠ S80), K97 (= K99), W272 (vs. gap), Y280 (= Y288)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
28% identity, 98% coverage: 5:330/334 of query aligns to 2:323/337 of 3nt2A
- active site: K97 (= K99), H176 (= H179)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), G11 (= G14), A12 (≠ R15), I13 (≠ M16), D35 (= D38), V36 (≠ P39), S74 (≠ A76), W75 (≠ P77), G76 (≠ A78), A78 (≠ S80), H79 (= H81), E96 (= E98), K97 (= K99), H176 (= H179), Y280 (= Y288)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
27% identity, 98% coverage: 5:330/334 of query aligns to 2:323/337 of 4l8vA
- active site: K97 (= K99), H176 (= H179)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R15), I13 (≠ M16), S74 (≠ A76), W75 (≠ P77), H79 (= H81), E96 (= E98), K97 (= K99), M126 (≠ N127), W272 (vs. gap), Y280 (= Y288)
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
28% identity, 90% coverage: 6:306/334 of query aligns to 3:300/339 of 4mjlD
- active site: K97 (= K99)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K99), H155 (≠ T156), N157 (≠ D158), D172 (≠ E175), T173 (= T176), H176 (= H179), Y236 (= Y241)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), A12 (≠ R15), M13 (= M16), D35 (= D38), I36 (≠ P39), V73 (≠ A75), S74 (≠ A76), H79 (= H81), E96 (= E98), K97 (= K99), M126 (≠ N127), D172 (≠ E175), W274 (≠ D280), Y282 (= Y288)
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
28% identity, 90% coverage: 6:306/334 of query aligns to 3:300/339 of 4mioD
- active site: K97 (= K99)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K99), H155 (≠ T156), N157 (≠ D158), D172 (≠ E175), T173 (= T176), H176 (= H179), Y236 (= Y241)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ R15), M13 (= M16), D35 (= D38), I36 (≠ P39), S74 (≠ A76), A78 (≠ S80), H79 (= H81), E96 (= E98), K97 (= K99), M126 (≠ N127), D172 (≠ E175), W274 (≠ D280), Y282 (= Y288)
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
28% identity, 90% coverage: 6:306/334 of query aligns to 3:300/339 of 4mioA
- active site: K97 (= K99)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G14), A12 (≠ R15), M13 (= M16), D35 (= D38), I36 (≠ P39), S74 (≠ A76), F75 (≠ P77), H79 (= H81), E96 (= E98), K97 (= K99), W274 (≠ D280), Y282 (= Y288)
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
28% identity, 90% coverage: 6:306/334 of query aligns to 3:300/339 of 4minA
- active site: K97 (= K99)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), A12 (≠ R15), M13 (= M16), D35 (= D38), I36 (≠ P39), V73 (≠ A75), S74 (≠ A76), F75 (≠ P77), H79 (= H81), E96 (= E98), K97 (= K99), Y282 (= Y288)
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
29% identity, 98% coverage: 7:334/334 of query aligns to 3:329/333 of Q2I8V6
- ASTI 9:12 (≠ AGRM 13:16) binding
- S10 (≠ G14) mutation to G: Almost no effect.
- A13 (≠ G17) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ D38) mutation to D: No activity.
- ST 33:34 (≠ DP 38:39) binding
- R38 (≠ Q43) binding
- TTNELH 71:76 (≠ APARSH 76:81) binding
- EK 93:94 (= EK 98:99) binding
- K94 (= K99) mutation to G: Less than 1% remaining activity.
- N120 (≠ G125) binding
- WR 162:163 (≠ WV 170:171) binding
- D176 (≠ E175) mutation to A: Less than 1% remaining activity.
- H180 (= H179) mutation to A: Less than 2% remaining activity.
- G206 (≠ K209) mutation to I: No effect.
- Y283 (= Y288) binding
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
29% identity, 98% coverage: 7:334/334 of query aligns to 2:328/332 of 2glxA
- active site: K93 (= K99), H179 (= H179)
- binding acetate ion: K93 (= K99), H179 (= H179)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G12), A8 (= A13), S9 (≠ G14), T10 (≠ R15), I11 (≠ M16), S32 (≠ D38), T33 (≠ P39), R37 (≠ Q43), S69 (≠ A75), T70 (≠ A76), N72 (≠ A78), H75 (= H81), E92 (= E98), K93 (= K99), H121 (≠ N127), W161 (= W170), R162 (≠ V171), Y282 (= Y288)
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
29% identity, 99% coverage: 6:334/334 of query aligns to 2:329/333 of 4koaA
- active site: K94 (= K99), H180 (= H179)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), A9 (= A13), S10 (≠ G14), T11 (≠ R15), I12 (≠ M16), S33 (≠ D38), S34 (≠ P39), R38 (≠ Q43), T71 (≠ A76), N73 (≠ A78), H76 (= H81), K94 (= K99), Q160 (≠ P168)
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
32% identity, 75% coverage: 4:254/334 of query aligns to 1:270/372 of 6a3iA
- binding Levoglucosan: K103 (= K99), Y132 (≠ R128), Y160 (≠ T156), Q162 (≠ D158), R175 (≠ I172), D188 (vs. gap), H192 (= H179)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F12 (≠ R15), M13 (= M16), E42 (≠ D38), A43 (≠ P39), P81 (= P77), N82 (≠ A78), L84 (≠ S80), H85 (= H81), E102 (= E98), K103 (= K99), W174 (≠ V171), R175 (≠ I172)
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
26% identity, 99% coverage: 4:334/334 of query aligns to 2:341/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (≠ F126), Q173 (≠ E175), H176 (= H179), E242 (≠ S255), M243 (= M256), R295 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G10 (= G12), G12 (= G14), R13 (= R15), A14 (≠ M16), D35 (= D38), P36 (= P39), R37 (≠ T40), A71 (= A75), S72 (≠ A76), P73 (= P77), F76 (≠ S80), Q80 (≠ L84), E94 (= E98), K95 (= K99), P96 (= P100), R161 (≠ A165), P163 (≠ S167), E164 (≠ P168)
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
27% identity, 80% coverage: 6:273/334 of query aligns to 2:268/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ R15), F152 (≠ T156), N154 (= N163), D175 (≠ E175), L176 (≠ T176), H179 (= H179), E236 (≠ Y241)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G14), F11 (≠ R15), M12 (= M16), D33 (= D38), L34 (≠ P39), T70 (≠ A75), T71 (≠ A76), P72 (= P77), N73 (≠ A78), L75 (≠ S80), H76 (= H81), Q79 (≠ L84), E93 (= E98), K94 (= K99), N122 (= N127), W161 (= W170), H179 (= H179)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
27% identity, 80% coverage: 6:273/334 of query aligns to 2:268/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ R15), N154 (= N163), D175 (≠ E175), H179 (= H179), E236 (≠ Y241)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G12), G10 (= G14), F11 (≠ R15), M12 (= M16), D33 (= D38), L34 (≠ P39), T70 (≠ A75), T71 (≠ A76), P72 (= P77), N73 (≠ A78), L75 (≠ S80), H76 (= H81), Q79 (≠ L84), E93 (= E98), K94 (= K99), N122 (= N127), W161 (= W170)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
27% identity, 80% coverage: 6:273/334 of query aligns to 2:268/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G14), F11 (≠ R15), M12 (= M16), D33 (= D38), L34 (≠ P39), T70 (≠ A75), T71 (≠ A76), P72 (= P77), N73 (≠ A78), L75 (≠ S80), H76 (= H81), Q79 (≠ L84), E93 (= E98), K94 (= K99), N122 (= N127), W161 (= W170), H179 (= H179)
Sites not aligning to the query:
Query Sequence
>GFF2172 FitnessBrowser__WCS417:GFF2172
MSTHNIRLGLIGAGRMGSFHGLTAARHIPGASLAAIADPTPGQAARLAAELGVSKVYTDP
QQLLDDPDIDGVLIAAPARSHAELVISAARAGKGIFCEKPMAITLDEADRAIAAAADARV
PLQVGFNRRFAKSFRTAHLDVAAGRIGTPQLLRSLTRDPALNNPANSPQWVIFLETLIHD
FDTLRYLNPGAEAVQVYVMADALIAPEYKSKGFLDTAVVAIRFDNGAIATAEANFQAVYG
YDVRGEVFGSAGMLSMGSLNDSDLLRYLAQGIQADTQRLDTDLLRDAYIAELNHFVDCLR
SGAKPMASGEDARAALAIARACIESFETGKAVAI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory