Comparing GFF218 FitnessBrowser__WCS417:GFF218 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
45% identity, 83% coverage: 40:258/264 of query aligns to 4:223/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
45% identity, 83% coverage: 40:258/264 of query aligns to 4:225/226 of 4zv1A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
45% identity, 86% coverage: 33:258/264 of query aligns to 3:228/229 of 5t0wA
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
40% identity, 87% coverage: 33:262/264 of query aligns to 10:238/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
40% identity, 87% coverage: 33:262/264 of query aligns to 10:238/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
40% identity, 87% coverage: 33:262/264 of query aligns to 10:238/241 of 3vvdA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
40% identity, 87% coverage: 33:262/264 of query aligns to 6:234/237 of 3vv5A
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
36% identity, 90% coverage: 27:263/264 of query aligns to 1:238/240 of 2ylnA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
34% identity, 86% coverage: 33:259/264 of query aligns to 3:228/229 of 6svfA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
35% identity, 84% coverage: 42:262/264 of query aligns to 28:257/260 of P0AEU0
Sites not aligning to the query:
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
35% identity, 84% coverage: 41:262/264 of query aligns to 27:257/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
35% identity, 84% coverage: 41:262/264 of query aligns to 5:235/238 of 1hslA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
36% identity, 81% coverage: 44:257/264 of query aligns to 18:233/235 of 4g4pA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
31% identity, 83% coverage: 39:258/264 of query aligns to 5:227/228 of 2y7iA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
36% identity, 83% coverage: 40:258/264 of query aligns to 1:222/224 of 4ymxA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
32% identity, 83% coverage: 40:258/264 of query aligns to 4:226/234 of 3k4uE
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
29% identity, 87% coverage: 33:262/264 of query aligns to 1:235/237 of 4i62A
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
32% identity, 84% coverage: 42:262/264 of query aligns to 3:232/235 of 5owfA
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
30% identity, 84% coverage: 42:263/264 of query aligns to 5:254/259 of 5ovzA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
30% identity, 84% coverage: 41:263/264 of query aligns to 3:253/254 of 5otaA
>GFF218 FitnessBrowser__WCS417:GFF218
MTISVFRRTLLVGTLGLALGAGLLGQAVAGEQLDNIKKAGEIKIGLEGTYPPFSFVDESG
KLSGFEVELSEALAKELGVKVKLQATPWDGILAALESKRLDAVVNQVTISEERKKKYDFS
KPYTVSGIQALVLTKNVGTIKTADDLAGKKVGVGLGTNYEQWLKDNQPKAIIKTYNDDPT
KFQDLRIGRIDTILIDRLAALEYAKKAKDTSVTGDAFSRQEAGIALRKGEPELLDAVNKA
LDKLRADGTLKKLSEKYFNADVTQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory