Comparing GFF2185 FitnessBrowser__WCS417:GFF2185 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
33% identity, 48% coverage: 7:267/542 of query aligns to 3:270/330 of P0AAH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
35% identity, 49% coverage: 24:286/542 of query aligns to 22:278/310 of 4fwiB
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
36% identity, 44% coverage: 24:259/542 of query aligns to 23:258/326 of Q8RDH4
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
33% identity, 42% coverage: 303:531/542 of query aligns to 21:253/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
32% identity, 41% coverage: 303:524/542 of query aligns to 21:246/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
32% identity, 41% coverage: 303:524/542 of query aligns to 21:246/250 of 7z16I
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 43% coverage: 296:529/542 of query aligns to 13:248/343 of P30750
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 41% coverage: 301:522/542 of query aligns to 42:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
33% identity, 41% coverage: 301:522/542 of query aligns to 42:263/382 of 7aheC
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 43% coverage: 296:529/542 of query aligns to 14:249/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 43% coverage: 296:529/542 of query aligns to 14:249/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 43% coverage: 296:529/542 of query aligns to 14:249/344 of 6cvlD
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
33% identity, 40% coverage: 301:519/542 of query aligns to 42:260/260 of 7ahdC
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 40% coverage: 300:517/542 of query aligns to 32:243/378 of P69874
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 44% coverage: 294:529/542 of query aligns to 14:248/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 44% coverage: 294:529/542 of query aligns to 14:248/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 44% coverage: 294:529/542 of query aligns to 14:248/353 of 1oxuA
Sites not aligning to the query:
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
34% identity, 44% coverage: 294:529/542 of query aligns to 14:248/353 of Q97UY8
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 41% coverage: 297:517/542 of query aligns to 17:230/393 of P9WQI3
1g291 Malk (see paper)
33% identity, 43% coverage: 292:524/542 of query aligns to 10:242/372 of 1g291
Sites not aligning to the query:
>GFF2185 FitnessBrowser__WCS417:GFF2185
MSANPVLLNVEHLKIRVGEHGPLAVDDLSFSIAPGEIVALVGESGSGKTMAARAAIGLLP
LPMQVCGGRLDFQGRDLASVSTEALRAIRGASIGMVFQEPMVSLNPALKIGQQMSEALKL
HTDLDPPQIRERCLTMLRRIGIKAAERCLESYPHQFSGGMRQRIMLASVMLLRPALLIAD
EPTTALDCLAQLDVIELMLELTREQGTAILFISHDLSLVARYAHKVVVMRHGKAVEQGSI
EDILLAPKAEYTRQLLEALPRRGVLAPLPVSNEPLVEVDQVCIEHPGPTTFWGKRQHTRV
VHSASLVIAPGETLALVGGSGSGKTTLGRSLVGLIKPCAGSIRFKGVDILKAANRTHRLQ
CQMIFQDPYSSLNPRMKIGEILAEPLRHEPGLNAAERRERVTQTLKDIGLGEQFVERFPH
QLSGGQRQRVAIGRALVRHPQLVIADEPISALDMTIQKQILELFERLQAQYGFACLFISH
DLAAVERIAHRVAVMHQGNVVEVGAREQIFDHPQHPYTRQLLAAASPLEQLPDGGYRIRP
AI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory