SitesBLAST
Comparing GFF2189 FitnessBrowser__WCS417:GFF2189 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9A3Q9 Omega-aminotransferase; Beta-alanine--pyruvate aminotransferase; EC 2.6.1.-; EC 2.6.1.18 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
54% identity, 99% coverage: 3:427/431 of query aligns to 10:435/439 of Q9A3Q9
- V227 (= V219) mutation to G: Decreases activity toward 3-aminobutanoate by 2-fold. Increases activity toward the aromatic beta-amino acid 3-amino-3-phenylpropanoate by 2-fold.
- R260 (= R252) mutation to L: Decreases activity toward 3-aminobutanoate by 30-fold.
- N285 (= N277) mutation to A: Decreases activity toward 3-aminobutanoate by 4-fold. Increases activity toward the aromatic beta-amino acid 3-amino-3-phenylpropanoate by 3-fold.
4b98A The structure of the omega aminotransferase from pseudomonas aeruginosa (see paper)
45% identity, 98% coverage: 6:428/431 of query aligns to 14:438/441 of 4b98A
- active site: F17 (= F9), Y146 (= Y138), E219 (= E211), D252 (= D244), I255 (= I247), K281 (= K273), Q414 (≠ V404)
- binding pyridoxal-5'-phosphate: G233 (= G225), Q236 (= Q228), F270 (= F262), G271 (= G263)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: L53 (= L45), W54 (= W46), F82 (= F74), S112 (= S104), G113 (= G105), S114 (= S106), Y146 (= Y138), H147 (= H139), G148 (= G140), E219 (= E211), S224 (= S216), D252 (= D244), V254 (= V246), I255 (= I247), K281 (= K273), Y319 (= Y309), T320 (= T310), R407 (= R397), Q414 (≠ V404)
Q9I700 Beta-alanine--pyruvate aminotransferase; Beta-A--Py AT; Beta-alanine--pyruvate transaminase; Omega-amino acid aminotransferase; Omega-amino acid AT; Omega-amino acid--pyruvate aminotransferase; Omega-APT; EC 2.6.1.18 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
45% identity, 98% coverage: 6:428/431 of query aligns to 21:445/448 of Q9I700
- W61 (= W46) binding
- T327 (= T310) binding
- R414 (= R397) binding
- Q421 (≠ V404) binding
4uhmA Characterization of a novel transaminase from pseudomonas sp. Strain aac (see paper)
44% identity, 98% coverage: 6:428/431 of query aligns to 8:432/435 of 4uhmA
- active site: F11 (= F9), Y140 (= Y138), E213 (= E211), D246 (= D244), I249 (= I247), K275 (= K273), Q408 (≠ V404)
- binding magnesium ion: A91 (≠ V89), D99 (= D97)
- binding pyridoxal-5'-phosphate: G107 (= G105), S108 (= S106), Y140 (= Y138), H141 (= H139), G142 (= G140), E213 (= E211), D246 (= D244), V248 (= V246), I249 (= I247), K275 (= K273)
3a8uX Crystal structure of omega-amino acid:pyruvate aminotransferase
43% identity, 98% coverage: 6:428/431 of query aligns to 13:438/441 of 3a8uX
- active site: Y145 (= Y138), D252 (= D244), K281 (= K273), Q414 (≠ V404)
- binding pyridoxal-5'-phosphate: S111 (= S104), G112 (= G105), S113 (= S106), Y145 (= Y138), H146 (= H139), G147 (= G140), E219 (= E211), D252 (= D244), V254 (= V246), I255 (= I247), K281 (= K273)
6s54A Transaminase from pseudomonas fluorescens (see paper)
36% identity, 96% coverage: 17:430/431 of query aligns to 29:451/453 of 6s54A
- active site: Y152 (= Y138), D258 (= D244), K287 (= K273)
- binding pyridoxal-5'-phosphate: G119 (= G105), S120 (= S106), Y152 (= Y138), H153 (= H139), G154 (= G140), E225 (= E211), D258 (= D244), V260 (= V246), I261 (= I247), K287 (= K273)
Sites not aligning to the query:
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
36% identity, 98% coverage: 8:430/431 of query aligns to 17:445/450 of 6gwiB
- active site: F18 (= F9), Y149 (= Y138), D255 (= D244), K284 (= K273)
- binding pyridoxal-5'-phosphate: S115 (= S104), G116 (= G105), S117 (= S106), Y149 (= Y138), H150 (= H139), G151 (= G140), E222 (= E211), D255 (= D244), V257 (= V246), I258 (= I247), K284 (= K273)
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
37% identity, 99% coverage: 3:427/431 of query aligns to 10:445/449 of 5lh9D
- active site: Y148 (= Y138), D255 (= D244), K284 (= K273), T321 (= T310)
- binding pyridoxal-5'-phosphate: G115 (= G105), S116 (= S106), Y148 (= Y138), H149 (= H139), G150 (= G140), E222 (= E211), D255 (= D244), V257 (= V246), K284 (= K273)
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
37% identity, 99% coverage: 3:427/431 of query aligns to 8:443/447 of 5lhaA
- active site: Y146 (= Y138), D253 (= D244), K282 (= K273), T319 (= T310)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G113 (= G105), S114 (= S106), Y146 (= Y138), H147 (= H139), G148 (= G140), E220 (= E211), D253 (= D244), K282 (= K273), Y318 (= Y309), T319 (= T310)
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
35% identity, 98% coverage: 8:430/431 of query aligns to 14:445/451 of 6g4fA
- active site: Y15 (≠ F9), Y146 (= Y138), D253 (= D244), K282 (= K273)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S112 (= S104), G113 (= G105), S114 (= S106), Y146 (= Y138), H147 (= H139), E220 (= E211), D253 (= D244), V255 (= V246), I256 (= I247), K282 (= K273)
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
35% identity, 98% coverage: 8:430/431 of query aligns to 14:445/451 of 6g4eA
- active site: Y15 (≠ F9), Y146 (= Y138), D253 (= D244), K282 (= K273)
- binding 6-aminohexanoic acid: K282 (= K273), R412 (= R397), M414 (≠ S399)
- binding pyridoxal-5'-phosphate: S112 (= S104), G113 (= G105), S114 (= S106), Y146 (= Y138), H147 (= H139), E220 (= E211), D253 (= D244), V255 (= V246), I256 (= I247), K282 (= K273)
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
35% identity, 98% coverage: 8:430/431 of query aligns to 14:445/453 of 6g4dB
- active site: Y15 (≠ F9), Y146 (= Y138), D253 (= D244), K282 (= K273)
- binding pyridoxal-5'-phosphate: S112 (= S104), G113 (= G105), S114 (= S106), Y146 (= Y138), H147 (= H139), E220 (= E211), D253 (= D244), V255 (= V246), I256 (= I247), K282 (= K273)
3i5tA Crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131
36% identity, 95% coverage: 18:427/431 of query aligns to 25:434/444 of 3i5tA
- active site: Y144 (= Y138), E216 (= E211), D249 (= D244), V252 (≠ I247), K279 (= K273), V411 (= V404)
- binding pyridoxal-5'-phosphate: G111 (= G105), S112 (= S106), Y144 (= Y138), H145 (= H139), E216 (= E211), D249 (= D244), V251 (= V246), K279 (= K273), Y315 (= Y309), T316 (= T310)
Sites not aligning to the query:
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
34% identity, 100% coverage: 1:431/431 of query aligns to 9:448/459 of D6R3B6
- SAGL 155:158 (≠ GLSV 145:148) mutation Missing: Low pungency phenotype, characterized by low levels of capsaicinoids, and accumulation of high levels of capsinoids, which are non-pungent capsaicinoid analogs.
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
35% identity, 95% coverage: 21:430/431 of query aligns to 3:417/422 of 7qx3A
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
34% identity, 97% coverage: 8:427/431 of query aligns to 14:435/443 of 6fyqA
- active site: F15 (= F9), Y147 (= Y138), D243 (= D244), K272 (= K273)
- binding pyridoxal-5'-phosphate: G114 (= G105), S115 (= S106), Y147 (= Y138), H148 (= H139), G149 (= G140), E210 (= E211), D243 (= D244), V245 (= V246), I246 (= I247), K272 (= K273)
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
34% identity, 99% coverage: 5:431/431 of query aligns to 55:492/504 of Q94CE5
- C98 (= C47) mutation to Y: In her1-1; loss of E2-hexenal responses.
- G103 (≠ H52) mutation to N: In her1-2; loss of E2-hexenal responses.
- G271 (= G217) mutation to E: In pop2-6; Loss of activity and complete sterility.
- G312 (≠ A258) mutation to D: In pop2-7; loss of activity.
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
36% identity, 97% coverage: 8:427/431 of query aligns to 19:443/448 of 6io1B
- active site: L20 (≠ F9), Y151 (= Y138), D257 (= D244), K286 (= K273)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (≠ S104), G118 (= G105), A119 (≠ S106), N122 (≠ V109), Y151 (= Y138), H152 (= H139), D257 (= D244), V259 (= V246), I260 (= I247), K286 (= K273)
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
35% identity, 95% coverage: 21:428/431 of query aligns to 32:445/454 of 7ypmA
- binding alanine: W57 (= W46), Y150 (= Y138)
- binding pyridoxal-5'-phosphate: S116 (= S104), G117 (= G105), S118 (= S106), Y150 (= Y138), G152 (= G140), E223 (= E211), D256 (= D244), V258 (= V246), I259 (= I247), K285 (= K273)
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
36% identity, 94% coverage: 25:429/431 of query aligns to 39:455/458 of 3fcrA
- active site: Y153 (= Y138), E227 (= E211), D260 (= D244), V263 (≠ I247), K289 (= K273), T326 (= T310), G430 (≠ V404)
- binding pyridoxal-5'-phosphate: G120 (= G105), S121 (= S106), Y153 (= Y138), H154 (= H139), E227 (= E211), D260 (= D244), V262 (= V246), K289 (= K273)
Sites not aligning to the query:
Query Sequence
>GFF2189 FitnessBrowser__WCS417:GFF2189
MTSSLWAPFTAMRPFNRQPMLFDRAAGMHYTTTEGRDVLDAMAGLWCVNAGHGQPRIVEA
IREAAGRLDFVSSFKMSHPAALTLADQLVAKAPANLDKVFFTNSGSEAVDTALKIARAYH
QARGDSRRTKLIGRAKGYHGMGFGGLSVSGIGRQKRDFGPLLGDVAHLPLPYDAGSRFSL
GQPEQGAHYADALLHLLEVHDPATVAAVIVEPVTGSGGVYAPPLGYLQKLREICDRHGLL
LIFDEVITGFGRVGHGFAAEAFGVTPDLMTLAKGLTNGAVPMGGVLVSGAVYEAFMQGPE
QAIELMHGYTYSAHPLACAAGLATLEVHEELGLNAHVRQIAPLWQNTALALREQALVLDV
RAIGLLCAVELKPREGAPGARAAGVAQRCFEAGVLVRASGENIVLSPPLIINQEQVAQVF
STLGKALEATR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory