SitesBLAST
Comparing GFF2214 FitnessBrowser__Marino:GFF2214 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
55% identity, 92% coverage: 29:492/507 of query aligns to 27:491/501 of 2qcuB
- binding flavin-adenine dinucleotide: E33 (= E35), A34 (≠ M36), C39 (≠ S41), T41 (= T43), S42 (= S44), S45 (= S47), S46 (= S48), L48 (= L50), H50 (= H52), A172 (≠ C174), T206 (≠ S208), W209 (= W211), G231 (= G233), R317 (= R319), G353 (= G355), K354 (= K356), L355 (≠ I357), T356 (= T358)
- binding phosphate ion: R54 (= R56), Y55 (= Y57), R317 (= R319), R332 (= R334)
Sites not aligning to the query:
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
55% identity, 92% coverage: 29:492/507 of query aligns to 27:491/495 of 2r46A
- binding flavin-adenine dinucleotide: L32 (≠ C34), E33 (= E35), A34 (≠ M36), T41 (= T43), S42 (= S44), A44 (≠ S46), S45 (= S47), S46 (= S48), L48 (= L50), A172 (≠ C174), T206 (≠ S208), G231 (= G233), R317 (= R319), G353 (= G355), K354 (= K356), L355 (≠ I357), T356 (= T358)
- binding phosphoenolpyruvate: R54 (= R56), Y55 (= Y57), R254 (= R256), T270 (= T272), D272 (= D274), R317 (= R319), R332 (= R334)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ K159), V455 (= V456), D456 (≠ K457), H457 (≠ N458), W459 (= W460)
Sites not aligning to the query:
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
55% identity, 92% coverage: 29:492/507 of query aligns to 27:491/495 of 2r45A
- binding 2-phosphoglyceric acid: R54 (= R56), Y55 (= Y57), R254 (= R256), I255 (= I257), T270 (= T272), R317 (= R319), R332 (= R334)
- binding flavin-adenine dinucleotide: E33 (= E35), A34 (≠ M36), C39 (≠ S41), A40 (= A42), T41 (= T43), S42 (= S44), A44 (≠ S46), S45 (= S47), S46 (= S48), L48 (= L50), A172 (≠ C174), T206 (≠ S208), G207 (= G209), W209 (= W211), G231 (= G233), R317 (= R319), G353 (= G355), K354 (= K356), L355 (≠ I357), T356 (= T358)
- binding phosphate ion: Q212 (≠ R214), G277 (= G279), P279 (= P281), V310 (≠ I312), Y398 (≠ L399), R401 (≠ T402), R405 (≠ D406), R462 (≠ T463), D464 (≠ E465), W468 (= W469)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ K159), V160 (≠ Q162), V455 (= V456), D456 (≠ K457), H457 (≠ N458), W459 (= W460)
Sites not aligning to the query:
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
31% identity, 95% coverage: 1:481/507 of query aligns to 14:513/557 of 2rgoA
- binding flavin-adenine dinucleotide: G25 (= G12), I28 (≠ V15), T29 (≠ N16), E48 (= E35), M49 (= M36), Q50 (≠ N37), T56 (= T43), S57 (= S44), A197 (≠ C174), S232 (= S208), G233 (= G209), W235 (= W211), G257 (= G233), G344 (= G317), L345 (≠ V318), Y357 (≠ E327), K382 (= K356), I383 (= I357), T384 (= T358)
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
30% identity, 90% coverage: 28:481/507 of query aligns to 39:484/530 of 2rgoB
- binding flavin-adenine dinucleotide: E46 (= E35), M47 (= M36), Q48 (≠ N37), T54 (= T43), S55 (= S44), S58 (= S47), T59 (≠ S48), A193 (≠ C174), S227 (= S208), G228 (= G209), W230 (= W211), L338 (≠ V318), R339 (= R319), Y350 (= Y336), K374 (= K356), I375 (= I357), T376 (= T358)
Sites not aligning to the query:
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 96% coverage: 4:490/507 of query aligns to 72:587/629 of Q9SS48
- S86 (≠ T18) mutation to F: In spd6-2; loss of 90% of activity.
- E546 (= E449) mutation to G: In spd6-1; loss of 90% of activity.
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
29% identity, 93% coverage: 1:472/507 of query aligns to 14:442/496 of 3da1A
- binding flavin-adenine dinucleotide: I24 (≠ V11), G27 (= G14), I28 (≠ V15), T29 (≠ N16), E48 (= E35), M49 (= M36), G55 (≠ A42), S57 (= S44), S60 (= S47), T61 (≠ S48), L63 (= L50), H65 (= H52), V151 (≠ T172), G187 (= G209), W189 (= W211), L193 (= L215), G210 (= G233), T250 (= T272), G296 (= G317), R298 (= R319), G319 (= G355), K320 (= K356), L321 (≠ I357)
Query Sequence
>GFF2214 FitnessBrowser__Marino:GFF2214
MEHEQFDVIVVGGGVNGTGIAMDAAGRGLKVLLCEMNDLASATSSSSSKLIHGGLRYLEH
YEFRLVREALAERESLLRNSPHIMWPMRFRLPHRPHLRPAWMIRTGLFLYDHLAKREILP
GSRSIKFGADDPLKPDITKGFEYSDGWVDDARLVVLTAKKAQQFGAQILTRTKCVKAEQG
SREWQVTLRDMTDETEKTVSAKAIVNASGPWVSRLFGETLSMPAPKMIRMVKGSHIVVPR
LNKGTEAYILQNEDERIVFVIPYEDEFSLVGTTDVDYEGDPKKAKISPEETDYLLNIVNS
HFKRQLVPSDVIWSYSGVRPLMDDEQENAQKASRDYSFEINSEKGKAPLISVFGGKITTY
RKLAEAATDKLCQFFPEAGGRWTKKGVLPGGDFANHEALEETLRRDYPWLAEKVISRYVR
TYGTTSYDILRNCTSMEDLGIHFAGTLYEREVEHLVKNEWAMTSEDILWRRTKQGLYASD
SDIESLERYLMKTVTTETRKTALHHSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory