Comparing GFF2219 HP15_2173 glucokinase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
1sz2B Crystal structure of e. Coli glucokinase in complex with glucose (see paper)
43% identity, 98% coverage: 4:316/321 of query aligns to 1:312/320 of 1sz2B
6da0A Crystal structure of glucokinase (nfhk) from naegleria fowleri (see paper)
24% identity, 83% coverage: 11:277/321 of query aligns to 32:330/378 of 6da0A
6vzzA Crystal structure of glucokinase from balamuthia mandrillaris in complex with glucose (see paper)
27% identity, 92% coverage: 11:305/321 of query aligns to 30:360/374 of 6vzzA
8dtcA Crystal structure of glucokinase with bound glucose from acanthamoeba castellanii
27% identity, 79% coverage: 11:265/321 of query aligns to 30:318/374 of 8dtcA
>GFF2219 HP15_2173 glucokinase
MTATHYSLVGDIGGTNARFALVEQGTVQPRAIKILPCGEYANLDDAVRDYLARVGVSEVD
GACLAVASPVRGTQVRMTNNHWLFDTEEVRAQFGWSRFKVINDFTAMALGVPHVANDHLV
HVCGGPGDSRRPRLVMGPGTGLGVSGLVPIEHGWVPLMTEGGHVDFAPTDDAEMAVLRIL
KARFGRVSVERILCGQGLLNLYQAHAEIQGVAAPLDAPEKITAAAVENTDRLARHTLSHF
CEILGRVAGNGVLTLGSTGGVFLCGGILPRFLEFFLESPFRNGFEDKGRMRPLLEFTPVY
VVTEPYTGLLGAAEALGNPEV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory