SitesBLAST
Comparing GFF2238 FitnessBrowser__Marino:GFF2238 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5oasA Crystal structure of malate synthase g from pseudomonas aeruginosa in apo form. (see paper)
71% identity, 100% coverage: 1:725/726 of query aligns to 4:727/728 of 5oasA
5vfbA 1.36 angstrom resolution crystal structure of malate synthase g from pseudomonas aeruginosa in complex with glycolic acid.
71% identity, 100% coverage: 2:725/726 of query aligns to 1:723/724 of 5vfbA
P9WK16 Malate synthase G; EC 2.3.3.9 from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) (see paper)
63% identity, 100% coverage: 1:726/726 of query aligns to 1:727/741 of P9WK16
- R339 (= R340) active site, Proton acceptor
- D633 (= D632) active site, Proton donor
2gq3A Mycobacterium tuberculosis malate synthase in complex with magnesium, malate, and coenzyme a (see paper)
63% identity, 100% coverage: 2:726/726 of query aligns to 1:720/720 of 2gq3A
- active site: D267 (= D272), E269 (= E274), R335 (= R340), E430 (= E432), D458 (= D460), D626 (= D632)
- binding coenzyme a: V114 (= V118), V115 (= V119), R121 (= R125), F122 (= F126), N125 (= N129), A126 (= A130), K301 (= K306), R308 (= R313), P539 (= P541), P541 (= P543), C612 (= C618), M624 (= M630), D626 (= D632)
- binding magnesium ion: H370 (= H375), K373 (= K378), N378 (= N380), G379 (= G381), L381 (≠ F383), E430 (= E432), D458 (= D460)
6axeA Crystal structure of a malate synthase g from mycobacterium marinum bound to acetyl coa
63% identity, 100% coverage: 1:725/726 of query aligns to 2:729/729 of 6axeA
- active site: D272 (= D272), E274 (= E274), R338 (= R340), E437 (= E432), D465 (= D460), D636 (= D632)
- binding acetyl coenzyme *a: V119 (= V118), V120 (= V119), R126 (= R125), F127 (= F126), N130 (= N129), A131 (= A130), R311 (= R313), R338 (= R340), M518 (= M513), W544 (= W539), P546 (= P541), P548 (= P543), C622 (= C618), K624 (= K620), M634 (= M630), D636 (= D632)
- binding magnesium ion: E437 (= E432), D465 (= D460)
6dkoA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-f-phenyldiketoacid (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:716/716 of 6dkoA
- active site: D270 (= D272), E272 (= E274), R332 (= R340), E424 (= E432), D452 (= D460), D622 (= D632)
- binding 4-(2,6-difluorophenyl)-2,4-dioxobutanoic acid: R332 (= R340), G449 (= G457), L451 (= L459), D452 (= D460), M505 (= M513), W531 (= W539), M620 (= M630), D622 (= D632)
- binding magnesium ion: E424 (= E432), D452 (= D460)
5cbiA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-chloro-2-hydroxybenzonitrile (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:719/719 of 5cbiA
- active site: D270 (= D272), E272 (= E274), R331 (= R340), E426 (= E432), D454 (= D460), D625 (= D632)
- binding 5-chloro-2-hydroxybenzonitrile: L53 (= L54), N54 (≠ A55), D57 (= D58), F125 (= F126), Y138 (= Y139), D139 (= D140), Y142 (= Y143), M507 (= M513), W533 (= W539), P535 (= P541), A611 (≠ C618), M623 (= M630), M623 (= M630), E624 (= E631), D625 (= D632)
- binding magnesium ion: E426 (= E432), D454 (= D460)
6bu1A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-3-oh-phenyldiketoacid (see paper)
62% identity, 100% coverage: 3:726/726 of query aligns to 1:712/712 of 6bu1A
- active site: D269 (= D272), E271 (= E274), R327 (= R340), E419 (= E432), D447 (= D460), D618 (= D632)
- binding (2Z)-4-(2-bromo-3-hydroxyphenyl)-2-hydroxy-4-oxobut-2-enoic acid: V116 (= V118), R327 (= R340), E419 (= E432), G444 (= G457), L446 (= L459), D447 (= D460), M500 (= M513), W526 (= W539), M616 (= M630), D618 (= D632)
- binding magnesium ion: E419 (= E432), D447 (= D460), V463 (≠ I476), R464 (= R477)
6dl9A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-cl-phenyldiketoacid (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:716/716 of 6dl9A
- active site: D270 (= D272), E272 (= E274), R328 (= R340), E423 (= E432), D451 (= D460), D622 (= D632)
- binding 4-(2,6-dichlorophenyl)-2,4-dioxobutanoic acid: V117 (= V118), R328 (= R340), E423 (= E432), G448 (= G457), L450 (= L459), D451 (= D460), M504 (= M513), W530 (= W539), M620 (= M630), D622 (= D632)
- binding magnesium ion: E423 (= E432), D451 (= D460)
5c9xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,4-dichloro-5-fluorobenzoic acid (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:716/716 of 5c9xA
- active site: D270 (= D272), E272 (= E274), R328 (= R340), E423 (= E432), D451 (= D460), D622 (= D632)
- binding 2,4-dichloro-5-fluorobenzoic acid: V117 (= V118), S274 (= S276), R328 (= R340), M504 (= M513), W530 (= W539), M620 (= M630), D622 (= D632)
- binding magnesium ion: K295 (= K297), H363 (= H375), K366 (= K378), N371 (= N380), G372 (= G381), L374 (≠ F383), E423 (= E432), D451 (= D460)
5c7vA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-pyrrole-2-carboxylic acid (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:716/716 of 5c7vA
5c9rA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-((4-chlorophenyl)thio)propanoic acid (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:717/717 of 5c9rA
- active site: D270 (= D272), E272 (= E274), R331 (= R340), E424 (= E432), D452 (= D460), D623 (= D632)
- binding 3-[(4-chlorophenyl)sulfanyl]propanoic acid: V117 (= V118), E424 (= E432), D452 (= D460), M505 (= M513), W531 (= W539), M621 (= M630), D623 (= D632)
- binding magnesium ion: E424 (= E432), D452 (= D460)
6dnpA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-3-methyl-6-f-phenyldiketoacid (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:712/712 of 6dnpA
- active site: D270 (= D272), E272 (= E274), R328 (= R340), E419 (= E432), D447 (= D460), D618 (= D632)
- binding (2Z)-4-(2,6-difluoro-3-methylphenyl)-2-hydroxy-4-oxobut-2-enoic acid: R328 (= R340), E419 (= E432), G444 (= G457), L446 (= L459), D447 (= D460), M500 (= M513), W526 (= W539), M616 (= M630), D618 (= D632)
- binding magnesium ion: E419 (= E432), D447 (= D460)
5drcA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-4-(1h-indol-3-yl)-4-oxobut-2-enoic acid (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:716/716 of 5drcA
- active site: D270 (= D272), E272 (= E274), R330 (= R340), E423 (= E432), D451 (= D460), D622 (= D632)
- binding (2Z)-2-hydroxy-4-(1H-indol-3-yl)-4-oxobut-2-enoic acid: R330 (= R340), E423 (= E432), G448 (= G457), L450 (= L459), D451 (= D460), M504 (= M513), W530 (= W539), M620 (= M630), D622 (= D632)
- binding magnesium ion: E423 (= E432), D451 (= D460), R468 (= R477), T471 (≠ A480)
5cakA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-3-(1h-indol-3-yl)propanoic acid (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:717/717 of 5cakA
- active site: D270 (= D272), E272 (= E274), R329 (= R340), E424 (= E432), D452 (= D460), D623 (= D632)
- binding (2R)-2-hydroxy-3-(1H-indol-3-yl)propanoic acid: V117 (= V118), L451 (= L459), M505 (= M513), E622 (= E631), D623 (= D632)
- binding magnesium ion: E424 (= E432), D452 (= D460)
5cbbA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-(3h-indol-3-ylidene)-2,5-dihydro-1h-pyrazole-3- carboxylate (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:713/713 of 5cbbA
- active site: D266 (= D272), E268 (= E274), R325 (= R340), E420 (= E432), D448 (= D460), D619 (= D632)
- binding (5E)-5-(3H-indol-3-ylidene)-2,5-dihydro-1H-pyrazole-3-carboxylic acid: V113 (= V118), S270 (= S276), F446 (= F458), L447 (= L459), M501 (= M513), W527 (= W539), M617 (= M630), E618 (= E631), D619 (= D632)
- binding magnesium ion: E420 (= E432), D448 (= D460)
5e9xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-chloro-6h-thieno[2,3-b]pyrrole-5-carboxylic acid (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:715/715 of 5e9xA
- active site: D267 (= D272), E269 (= E274), R327 (= R340), E422 (= E432), D450 (= D460), D621 (= D632)
- binding 2-chloranyl-6~{H}-thieno[2,3-b]pyrrole-5-carboxylic acid: V114 (= V118), S271 (= S276), M503 (= M513), M619 (= M630), E620 (= E631), D621 (= D632)
- binding magnesium ion: E422 (= E432), D450 (= D460)
5t8gA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-oxo-4-((thiophene-2-carbonyl)oxy)butanoic acid (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:714/714 of 5t8gA
- active site: D270 (= D272), E272 (= E274), R328 (= R340), E421 (= E432), D449 (= D460), D620 (= D632)
- binding (3E)-2-oxo-4-[(thiophen-2-ylcarbonyl)oxy]but-3-enoic acid: V117 (= V118), R328 (= R340), E421 (= E432), G446 (= G457), L448 (= L459), D449 (= D460), M502 (= M513), W528 (= W539), E619 (= E631), D620 (= D632)
- binding magnesium ion: E421 (= E432), D449 (= D460), R466 (= R477), T469 (≠ A480)
5dx7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-(5-chlorothiophen-2-yl)isoxazole-3-carboxylic acid (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:714/714 of 5dx7A
- active site: D270 (= D272), E272 (= E274), R328 (= R340), E421 (= E432), D449 (= D460), D620 (= D632)
- binding 5-(5-chlorothiophen-2-yl)-1,2-oxazole-3-carboxylic acid: V117 (= V118), M502 (= M513), M618 (= M630), D620 (= D632)
- binding magnesium ion: E421 (= E432), D449 (= D460)
5c9uA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-(2-(2,4-dichlorophenyl)hydrazinyl)-2-oxoacetic acid (see paper)
62% identity, 100% coverage: 2:726/726 of query aligns to 1:714/714 of 5c9uA
- active site: D270 (= D272), E272 (= E274), R328 (= R340), E421 (= E432), D449 (= D460), D620 (= D632)
- binding [2-(2,4-dichlorophenyl)hydrazinyl](oxo)acetic acid: E421 (= E432), G446 (= G457), L448 (= L459), D449 (= D460), M502 (= M513), W528 (= W539), M618 (= M630), E619 (= E631), D620 (= D632)
- binding magnesium ion: E421 (= E432), D449 (= D460)
Query Sequence
>GFF2238 FitnessBrowser__Marino:GFF2238
MTERVQVGGIQVAKNLYDFVNNEAIPGTGIDADKFWAEFDKIVNELAPRNRELLAKRDAI
QEKMDSWNRDHKGQKLDMGEYKSFLKDIGYLVDEPSEFKISTSNVDPEVATMAGPQLVVP
IMNARFALNAANARWGSLYDALYGTDAISEEDGAEKGRGYNPVRGAKVIEWARNLLDSSA
PLASGSHKDAAKYVVVGGKLVVKLQNGESTGLKDEAGFVGYTGAADAPTGVLLVKNGMHF
EIQIDATHPIGKDDGAHVKDVLMESALTTIMDCEDSVAAVDADDKALAYRNWLGLMKGDL
QETFEKGGEQLTRKMNADRTYTAADGSELSLKGRSLMFIRNVGHLMTNPAILLKDGNEVP
EGLMDGLITSLIAIHDMKGNGKFQNSTKGSMYIVKPKMHGPEEVAFTNEFFGRVEDALSL
PRFSLKVGIMDEERRTTVNLKACIHAAKERAVFINTGFLDRTGDEIHTSMELGPFIRKGA
MKQATWINAYEQWNVDIGLETGFRGVAQIGKGMWAMPDLMAGMLEAKIGHPKAGANTAWV
PSPTAATLHATHYHQVSVADVQKQLESRTRAALDDILTVPVMDDPASLSAEDIQQELDNN
AQGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRIASQLLANWLHHGICSEDQIMET
MKRMAAVVDKQNAGDSAYRPMAGNFDDSVAFQAALDLVLKGREQPNGYTEPLLHAYRLKA
KAKYGQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory