Comparing GFF2245 HP15_2195 amino acid ABC transporter, permease protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
34% identity, 31% coverage: 260:382/395 of query aligns to 85:210/215 of 4ymtC
Sites not aligning to the query:
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
34% identity, 31% coverage: 260:382/395 of query aligns to 85:210/214 of 4ymwC
Sites not aligning to the query:
>GFF2245 HP15_2195 amino acid ABC transporter, permease protein
MKKQTIDTRPAGPKPWYDPRVRSLFFQAVAIALVFWGGWILVDNTLSNMESRGISTGFGF
LGETAGFGIIMNLVPYDATMSYGRTFWVGLTNTLLVSAMGVVAATILGFIIGVARLSSNW
LVAKMALVYIEVIRNIPLLLQIFFWYFAVLSNLPSPRQSVDVGGALFLNNRGLYLPDPVT
QEGFGIVWGGILLAIAAVVGIRIWAKKRQLATGQIFPTFKVGVAILVLVPIISYLVAGRP
LEWDLPALRGFNFGGGITIIPELAALWIALSLYTASFIAEIVRSGILSVSKGQTEASKAL
GLPNGLTLRLVVIPQAMRVIIPPLTSQYLNLVKNSSLATAIGYPDLVAVFMGTTLNQTGQ
AVEVVAITMAVYLTISLLISLFMNIYNRAVAIKER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory