Comparing GFF2246 FitnessBrowser__Phaeo:GFF2246 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
50% identity, 75% coverage: 6:268/352 of query aligns to 3:265/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
50% identity, 75% coverage: 6:268/352 of query aligns to 3:265/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
50% identity, 73% coverage: 6:263/352 of query aligns to 3:260/260 of 7ahdC
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 74% coverage: 5:266/352 of query aligns to 1:241/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 74% coverage: 5:266/352 of query aligns to 2:242/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 74% coverage: 5:266/352 of query aligns to 2:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 74% coverage: 5:266/352 of query aligns to 2:242/344 of 3tuiC
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 76% coverage: 4:269/352 of query aligns to 1:239/241 of 4u00A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 76% coverage: 4:270/352 of query aligns to 16:252/378 of P69874
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
35% identity, 64% coverage: 45:269/352 of query aligns to 17:239/240 of 4ymuJ
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
38% identity, 64% coverage: 45:269/352 of query aligns to 19:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
38% identity, 64% coverage: 45:269/352 of query aligns to 19:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
38% identity, 64% coverage: 45:269/352 of query aligns to 19:241/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
38% identity, 64% coverage: 45:269/352 of query aligns to 19:241/242 of 2oljA
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
32% identity, 68% coverage: 29:266/352 of query aligns to 3:243/375 of 2d62A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
38% identity, 59% coverage: 42:247/352 of query aligns to 18:226/232 of 1f3oA
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
38% identity, 58% coverage: 42:244/352 of query aligns to 18:223/230 of 1l2tA
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
34% identity, 63% coverage: 46:267/352 of query aligns to 21:241/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
34% identity, 63% coverage: 46:267/352 of query aligns to 21:241/263 of 7d08B
Sites not aligning to the query:
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
34% identity, 63% coverage: 46:267/352 of query aligns to 19:239/253 of 6z5uK
Sites not aligning to the query:
>GFF2246 FitnessBrowser__Phaeo:GFF2246
MTQPMVRLSGLYKIFGARDKDVLHHVQGGMGKEELLAQHKHVLGLNNINVDMQAGEITVV
MGLSGSGKSTLIRHLNRLIEPTAGEIIVQGEDVMQLSEDGLRHARQEKMSMVFQKFALLP
HKTVLKNAGMPLSVRGEDEATCDREAAKWLERVGLSGFENHYPAQLSGGMQQRVGIARAL
TANTPIMLMDEAFSALDPLIRTDMQDLLLELQKELHKTIIFITHDLDEALKLADHLVILK
DGFVVQQGEPQHILLNPNDPYIEDFVSDINRARVLRVRSIMTPLVGGKVPKDAHGEVDVN
DTLESMIARSGGDTSHAYVVKDGEQTVGTLDMTELVRALVPRVASEASARQS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory