Comparing GFF2249 FitnessBrowser__Marino:GFF2249 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
7cdyA Crystal structure of glucose dehydrogenase
46% identity, 66% coverage: 172:509/511 of query aligns to 2:343/346 of 7cdyA
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
42% identity, 71% coverage: 151:511/511 of query aligns to 13:369/371 of P75804
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
42% identity, 67% coverage: 172:511/511 of query aligns to 4:347/348 of 2g8sA
7cgzA Glucose dehydrogenase
43% identity, 66% coverage: 172:509/511 of query aligns to 2:318/321 of 7cgzA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
36% identity, 65% coverage: 173:505/511 of query aligns to 4:319/333 of 2ismB
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
38% identity, 66% coverage: 171:505/511 of query aligns to 4:320/338 of 3a9hA
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
38% identity, 66% coverage: 171:505/511 of query aligns to 4:320/338 of 3a9gA
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
33% identity, 65% coverage: 173:505/511 of query aligns to 11:318/334 of 3dasA
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
27% identity, 67% coverage: 170:510/511 of query aligns to 16:434/444 of 1cq1A
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
27% identity, 67% coverage: 170:510/511 of query aligns to 16:434/444 of 1c9uA
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
27% identity, 67% coverage: 170:510/511 of query aligns to 16:440/453 of 5minB
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
27% identity, 65% coverage: 170:502/511 of query aligns to 40:450/478 of P13650
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
27% identity, 67% coverage: 170:510/511 of query aligns to 16:438/448 of 1cruA
7pgnA Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
24% identity, 36% coverage: 171:356/511 of query aligns to 5:209/437 of 7pgnA
Sites not aligning to the query:
7pgnB Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
24% identity, 36% coverage: 171:356/511 of query aligns to 4:208/438 of 7pgnB
Sites not aligning to the query:
2wfxB Crystal structure of the complex between human hedgehog-interacting protein hip and sonic hedgehog in the presence of calcium (see paper)
24% identity, 36% coverage: 171:356/511 of query aligns to 3:203/417 of 2wfxB
Sites not aligning to the query:
Q96QV1 Hedgehog-interacting protein; HHIP; HIP from Homo sapiens (Human) (see 3 papers)
22% identity, 38% coverage: 163:356/511 of query aligns to 209:428/700 of Q96QV1
Sites not aligning to the query:
7pgmB Hhip-c in complex with heparin (see paper)
23% identity, 36% coverage: 171:356/511 of query aligns to 4:203/427 of 7pgmB
Sites not aligning to the query:
>GFF2249 FitnessBrowser__Marino:GFF2249
MALAVGVILGTVVQTQLNLWALQAMGVAVGLDARISATGHDLVSFAPLYLLLFGLSFLIS
QGAAAVVSRFVGRGLRVPLFGLAGASGLWVALVLVNALAPMPTLIAATRTGGGLLAMLLT
AAFAGALFARLTARPATGVSSHASGTLLAFCLAVGLGALPGPTQAQSLSDYTVETLTSGL
EHPWSLAFLPGGGALVTERAGRLRMISEEWELGQAPITGVPPVFNDAQAGLFDVLLSPDF
ENNQLVFLAYSCGTASANHLCVARGQLQAEALTEVVEIFRAKPAKEGSAHYGGRMAWLPD
GTLIVTLGDGFDYREQAQNLSSHLGKIVRLNPDGSVPADNPFVGREGALPEIYSYGHRNV
QGLVFDSVENVLIAHEHGPRGGDEINIIEPGHNYGWPVITHGIDYTGAMITPFVEREGME
QPLLHWTPSIAPSGMTRYRGELFPDWQGNLLVGALADKSVHRVTLEAGEASDVESLFEAM
GERIRDVATGPDGAVYLLTDSADGRILRILP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory