Comparing GFF2258 FitnessBrowser__WCS417:GFF2258 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ryaA Crystal structure of abc transporter solute binding protein avi_3567 from agrobacterium vitis s4, target efi-510645, with bound d-mannitol
62% identity, 95% coverage: 23:436/436 of query aligns to 1:417/417 of 4ryaA
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
28% identity, 69% coverage: 25:325/436 of query aligns to 7:310/399 of 5iaiA
Sites not aligning to the query:
6dtqA Maltose bound t. Maritima male3 (see paper)
27% identity, 77% coverage: 39:372/436 of query aligns to 18:348/391 of 6dtqA
Sites not aligning to the query:
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
25% identity, 89% coverage: 46:431/436 of query aligns to 27:407/407 of 1eu8A
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
25% identity, 89% coverage: 46:431/436 of query aligns to 68:448/450 of Q7LYW7
Sites not aligning to the query:
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
23% identity, 88% coverage: 44:427/436 of query aligns to 24:389/393 of 5ci5A
Sites not aligning to the query:
5ysdA Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
24% identity, 84% coverage: 66:431/436 of query aligns to 42:381/387 of 5ysdA
Sites not aligning to the query:
5ysbA Crystal structure of beta-1,2-glucooligosaccharide binding protein in ligand-free form (see paper)
24% identity, 84% coverage: 66:431/436 of query aligns to 41:380/386 of 5ysbA
Sites not aligning to the query:
5ysdB Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
24% identity, 84% coverage: 66:431/436 of query aligns to 42:381/389 of 5ysdB
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
25% identity, 66% coverage: 46:332/436 of query aligns to 22:302/382 of 7yzuA
Sites not aligning to the query:
7qhvAAA Sulfoquinovosyl binding protein (see paper)
23% identity, 88% coverage: 46:430/436 of query aligns to 24:386/390 of 7qhvAAA
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
23% identity, 88% coverage: 46:430/436 of query aligns to 25:388/389 of 7ofyA
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
23% identity, 88% coverage: 46:430/436 of query aligns to 53:416/416 of A9CEY9
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
25% identity, 66% coverage: 46:332/436 of query aligns to 23:305/384 of 7yzsAAA
Sites not aligning to the query:
3k02A Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
23% identity, 92% coverage: 30:430/436 of query aligns to 11:385/388 of 3k02A
3jzjA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
23% identity, 92% coverage: 30:430/436 of query aligns to 11:385/388 of 3jzjA
8s5bA Sulfoquinovosyl glycerol-binding protein SmoF (see paper)
25% identity, 66% coverage: 46:332/436 of query aligns to 18:297/377 of 8s5bA
Sites not aligning to the query:
4r9gA Cpmnbp1 with mannotriose bound (see paper)
24% identity, 69% coverage: 42:342/436 of query aligns to 21:324/394 of 4r9gA
Sites not aligning to the query:
6jahA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with glucose (see paper)
22% identity, 73% coverage: 113:430/436 of query aligns to 93:400/404 of 6jahA
Sites not aligning to the query:
6jagA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with sucrose (see paper)
22% identity, 73% coverage: 113:430/436 of query aligns to 93:400/404 of 6jagA
Sites not aligning to the query:
>GFF2258 FitnessBrowser__WCS417:GFF2258
MSKLPQALFLLSGLALAIPSHAADTVTIATVNNSDMIRMQRLSKVFEEQHPDIKLNWVVL
EENVLRQRLTTDIATQGGQFDVLTIGTYETPLWGAKHWLEPLTQLPPDYDADDIFPSVRQ
GLSVNNTLYALPFYGESTVTYYRTDLFKQAGLSMPAHPTWSQLGEFAAKLTAKDKGQYGM
CLRGKAGWGENIALLSTMANAFGARWFDEQWKPELTSPEWTAAANFYVNTLKQYGPPGVS
SNGFNETLALFNSGKCAIWVDASVAGSFTTDKSQSKVADSVGFAAAPTEVTDKGSSWLYA
WSLAIPATSKHKDAAKAFISWATSKDYIQLVADKEGITNVPPGTRQSTYSEAYLKAAPFA
QVTLEMMKHADPAHPSAKPVPYVGIQYVTIPEFQAIGTSVGKLFSAALTGGMSVDQALLD
AQSTTEREMKRAGYPK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory