SitesBLAST
Comparing GFF2259 FitnessBrowser__WCS417:GFF2259 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6pejA Structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol
82% identity, 100% coverage: 1:257/257 of query aligns to 1:257/257 of 6pejA
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
37% identity, 98% coverage: 7:257/257 of query aligns to 3:256/256 of Q48436
- 6:33 (vs. 10:37, 50% identical) binding
- D59 (= D60) binding
- K156 (= K157) binding
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
37% identity, 98% coverage: 7:257/257 of query aligns to 3:256/256 of 1gegE
- active site: G13 (= G17), S139 (= S140), Y152 (= Y153), K156 (= K157), V197 (≠ F198)
- binding alpha-D-glucopyranose: R63 (≠ Q64), D64 (≠ A65), F67 (≠ D68), E123 (≠ R124)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), Q12 (≠ R16), I14 (= I18), D33 (= D37), Y34 (≠ I38), V58 (≠ M59), D59 (= D60), V60 (= V61), N86 (= N87), A87 (= A88), I109 (= I110), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P183), V185 (= V186), T187 (≠ G188), M189 (≠ H190)
3wyeA Crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with NAD+
37% identity, 98% coverage: 7:257/257 of query aligns to 2:255/255 of 3wyeA
- active site: G12 (= G17), S138 (= S140), Y151 (= Y153), K155 (= K157), L196 (≠ F198)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), Q11 (≠ R16), G12 (= G17), I13 (= I18), D32 (= D37), Y33 (≠ I38), V57 (≠ M59), D58 (= D60), V59 (= V61), N85 (= N87), A86 (= A88), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), V184 (= V186), T186 (≠ G188), M188 (≠ H190), W189 (= W191)
3a28C Crystal structure of l-2,3-butanediol dehydrogenase (see paper)
38% identity, 98% coverage: 7:257/257 of query aligns to 2:257/257 of 3a28C
- active site: G12 (= G17), S140 (= S140), Y153 (= Y153), K157 (= K157), L198 (≠ F198)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), Q11 (≠ R16), I13 (= I18), D32 (= D37), L33 (≠ I38), Q36 (= Q41), L59 (≠ M59), D60 (= D60), V61 (= V61), N87 (= N87), S140 (= S140), Y153 (= Y153), K157 (= K157), P183 (= P183), V186 (= V186), T188 (≠ G188), M190 (≠ H190), W191 (= W191)
Q9ZNN8 L-2,3-butanediol dehydrogenase; L-BDH; (S,S)-butanediol dehydrogenase; Diacetyl reductase [(S)-acetoin forming]; EC 1.1.1.76; EC 1.1.1.304 from Corynebacterium glutamicum (Brevibacterium saccharolyticum) (see paper)
38% identity, 98% coverage: 7:257/257 of query aligns to 3:258/258 of Q9ZNN8
- QGI 12:14 (≠ RGI 16:18) binding
- D33 (= D37) binding
- Q37 (= Q41) binding
- DV 61:62 (= DV 60:61) binding
- N88 (= N87) binding
- I142 (≠ Q141) mutation to Q: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with N-148.; mutation to Q: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- F148 (≠ E147) mutation to N: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with Q-142.; mutation to N: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- Y154 (= Y153) binding
- K158 (= K157) binding
- PGIVGT 184:189 (≠ PGVVDG 183:188) binding
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 100% coverage: 1:256/257 of query aligns to 2:244/244 of 4nbuB
- active site: G18 (= G17), N111 (= N111), S139 (= S140), Q149 (≠ V150), Y152 (= Y153), K156 (= K157)
- binding acetoacetyl-coenzyme a: D93 (≠ L93), K98 (≠ D98), S139 (= S140), N146 (≠ E147), V147 (≠ P148), Q149 (≠ V150), Y152 (= Y153), F184 (≠ V185), M189 (≠ L197), K200 (≠ R212)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ R16), G18 (= G17), I19 (= I18), D38 (= D37), F39 (≠ I38), V59 (≠ M59), D60 (= D60), V61 (= V61), N87 (= N87), A88 (= A88), G89 (≠ A89), I90 (≠ L90), T137 (≠ M138), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P183), F184 (≠ V185), T185 (≠ V186), T187 (≠ D195), M189 (≠ L197)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
37% identity, 99% coverage: 4:257/257 of query aligns to 5:258/258 of 3ak4A
- active site: G18 (= G17), S141 (= S140), L151 (≠ V150), Y154 (= Y153), K158 (= K157), E199 (≠ F198)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ R16), G18 (= G17), I19 (= I18), D38 (= D37), L39 (≠ I38), V60 (≠ M59), D61 (= D60), V62 (= V61), N88 (= N87), A89 (= A88), G90 (≠ A89), T139 (≠ M138), S141 (= S140), Y154 (= Y153), K158 (= K157), G185 (= G184), V187 (= V186), T189 (≠ G188), M191 (≠ H190)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
37% identity, 97% coverage: 7:256/257 of query aligns to 5:246/246 of 3osuA
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
37% identity, 98% coverage: 7:257/257 of query aligns to 6:254/256 of 7do7A
- active site: G16 (= G17), S146 (= S140), Y159 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), R15 (= R16), G16 (= G17), I17 (= I18), S37 (≠ A36), D66 (= D60), A67 (≠ V61), N93 (= N87), A94 (= A88), G95 (≠ A89), I96 (≠ L90), V144 (≠ M138), S145 (≠ A139), S146 (= S140), Y159 (= Y153), K163 (= K157), P189 (= P183), G190 (= G184), I192 (≠ V186), T194 (≠ L197), I196 (≠ A199)
- binding beta-L-rhamnopyranose: F99 (≠ L93), S146 (= S140), S148 (≠ A142), Q156 (≠ V150), Y159 (= Y153), N197 (≠ K200), D235 (≠ K238), M236 (≠ E239), R238 (≠ D241)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
37% identity, 98% coverage: 7:257/257 of query aligns to 6:254/256 of 7b81A
- active site: G16 (= G17), S146 (= S140), Y159 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S14 (≠ A15), R15 (= R16), I17 (= I18), D66 (= D60), A67 (≠ V61), N93 (= N87), A94 (= A88), G95 (≠ A89), I96 (≠ L90), T116 (≠ I110), V144 (≠ M138), S146 (= S140), Y159 (= Y153), K163 (= K157), P189 (= P183), G190 (= G184), I192 (≠ V186), T194 (≠ L197), I196 (≠ A199)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
36% identity, 97% coverage: 7:256/257 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G17), S138 (= S140), Q148 (≠ V150), Y151 (= Y153), K155 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (≠ A15), R11 (= R16), I13 (= I18), N31 (≠ A36), Y32 (≠ D37), A33 (≠ I38), G34 (vs. gap), S35 (≠ D39), A58 (≠ M59), N59 (≠ D60), V60 (= V61), N86 (= N87), A87 (= A88), T109 (≠ I110), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
36% identity, 98% coverage: 3:253/257 of query aligns to 2:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), Q15 (≠ R16), G16 (= G17), I17 (= I18), D36 (= D37), V63 (= V61), N89 (= N87), A91 (= A89), S94 (≠ D92), I142 (≠ M138), S143 (≠ A139), S144 (= S140), Y157 (= Y153), K161 (= K157), P187 (= P183), H188 (≠ G184), I190 (≠ V186), I194 (≠ A199)
1zemA Crystal structure of NAD+-bound xylitol dehydrogenase (see paper)
35% identity, 98% coverage: 2:253/257 of query aligns to 1:260/260 of 1zemA
- active site: N16 (≠ G17), S142 (= S140), Y155 (= Y153), K159 (= K157), D212 (≠ A205)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G15 (≠ R16), N16 (≠ G17), I17 (= I18), D36 (= D37), M37 (≠ I38), D62 (= D60), V63 (= V61), N89 (= N87), A90 (= A88), G91 (≠ A89), T140 (≠ M138), S142 (= S140), Y155 (= Y153), K159 (= K157), P185 (= P183), M188 (≠ V186)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
36% identity, 98% coverage: 4:256/257 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G17), S142 (= S140), Q152 (≠ V150), Y155 (= Y153), K159 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ A15), R15 (= R16), G16 (= G17), I17 (= I18), N35 (≠ A36), Y36 (vs. gap), N37 (≠ D37), G38 (≠ I38), S39 (≠ D39), N63 (≠ D60), V64 (= V61), N90 (= N87), A91 (= A88), I93 (≠ L90), I113 (= I110), S142 (= S140), Y155 (= Y153), K159 (= K157), P185 (= P183), I188 (≠ V186), T190 (≠ G188)
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
36% identity, 98% coverage: 7:257/257 of query aligns to 6:245/247 of 7do6A
- active site: G16 (= G17), S146 (= S140), Y159 (= Y153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ A15), R15 (= R16), G16 (= G17), I17 (= I18), H36 (vs. gap), S37 (≠ A36), G42 (≠ Q41), D66 (= D60), A67 (≠ V61), N93 (= N87), A94 (= A88), G95 (≠ A89), I96 (≠ L90), T116 (≠ I110), S146 (= S140), Y159 (= Y153), K163 (= K157), I192 (≠ V186)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
37% identity, 98% coverage: 3:253/257 of query aligns to 13:256/261 of 5u9pB
- active site: G27 (= G17), S152 (= S140), Y165 (= Y153), K169 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G13), R26 (= R16), G27 (= G17), I28 (= I18), R48 (≠ I38), D73 (= D60), V74 (= V61), N100 (= N87), A101 (= A88), I150 (≠ M138), Y165 (= Y153), K169 (= K157), P195 (= P183), F198 (≠ V186), T200 (≠ G188), L202 (≠ H190), N203 (≠ W191)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
35% identity, 98% coverage: 4:256/257 of query aligns to 3:243/244 of 6t77A
- active site: G16 (= G17), S138 (= S140), Y151 (= Y153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ A15), R15 (= R16), T37 (≠ I38), L58 (≠ M59), N59 (≠ D60), V60 (= V61), A87 (= A88), G88 (≠ A89), I89 (≠ L90)
3rwbA Crystal structure of complex of 4pal (4-pyridoxolactone) and pldh (tetrameric pyridoxal 4-dehydrogenase) from mesorhizobium loti
35% identity, 98% coverage: 2:253/257 of query aligns to 2:243/247 of 3rwbA
- active site: G17 (= G17), S140 (= S140), Y153 (= Y153), K157 (= K157)
- binding 7-hydroxy-6-methylfuro[3,4-c]pyridin-1(3H)-one: S140 (= S140), N141 (≠ Q141), T142 (≠ A142), M150 (≠ V150), Y153 (= Y153), L185 (≠ V185), H196 (≠ K200)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), Q16 (≠ R16), G17 (= G17), I18 (= I18), D37 (= D37), I38 (= I38), D60 (= D60), I61 (≠ V61), N87 (= N87), A88 (= A88), S89 (≠ A89), I138 (≠ M138), S140 (= S140), Y153 (= Y153), K157 (= K157), P183 (= P183), L185 (≠ V185), I186 (≠ V186), S188 (≠ G188), G190 (= G193), V191 (= V194)
3ndrA Crystal structure of tetrameric pyridoxal 4-dehydrogenase from mesorhizobium loti
35% identity, 98% coverage: 2:253/257 of query aligns to 2:243/247 of 3ndrA
- active site: G17 (= G17), S140 (= S140), Y153 (= Y153), K157 (= K157)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), Q16 (≠ R16), G17 (= G17), I18 (= I18), D37 (= D37), I38 (= I38), D60 (= D60), I61 (≠ V61), N87 (= N87), A88 (= A88), S89 (≠ A89), V110 (≠ I110), I138 (≠ M138), S140 (= S140), Y153 (= Y153), K157 (= K157), P183 (= P183), L185 (≠ V185), I186 (≠ V186), S188 (≠ G188), G190 (= G193), V191 (= V194)
Query Sequence
>GFF2259 FitnessBrowser__WCS417:GFF2259
MKRLEGKSALITGSARGIGRAFAQAYIAEGATVAIADIDLQRAQATAAELGPQAYAVAMD
VTDQASIDGAITAVVAQAGKLDILINNAALFDLAPIVDITRDSYDRLFSINVAGTLFTLQ
AAARQMIRQGHGGKIINMASQAGRRGEPLVAIYCATKAAVISLTQSAGLNLIKQGINVNA
IAPGVVDGEHWDGVDALFAKHEGLAPGEKKQRVGAEVPFGRMGTAEDLTGMAIFLASKEA
DYVVAQTYNVDGGNWMN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory