SitesBLAST
Comparing GFF2273 FitnessBrowser__Phaeo:GFF2273 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
31% identity, 97% coverage: 2:281/288 of query aligns to 3:283/287 of 3pefA
- binding glycerol: D67 (= D67), G123 (= G120), K171 (= K168), N175 (= N172), M178 (≠ I175), L203 (≠ F200), G207 (≠ E204), N213 (≠ A210), A217 (≠ K214), F232 (= F230), H236 (≠ L234), K239 (= K237), R242 (≠ E240), R269 (≠ E267)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G9), I11 (≠ R10), M12 (= M11), N31 (= N30), R32 (= R31), S33 (≠ T32), K36 (= K35), M64 (= M64), L65 (= L65), A66 (= A66), A70 (≠ S70), E73 (≠ A73), T96 (= T94), V121 (= V118), G123 (= G120), S124 (≠ A121), A231 (≠ T229), F232 (= F230), H236 (≠ L234), K239 (= K237)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
31% identity, 97% coverage: 4:283/288 of query aligns to 5:285/287 of 3pduA
- binding glycerol: R242 (≠ E240), E246 (≠ D244), E246 (≠ D244), R250 (≠ K248)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), G10 (= G9), I11 (≠ R10), M12 (= M11), N31 (= N30), R32 (= R31), N33 (≠ T32), M64 (= M64), L65 (= L65), A66 (= A66), A70 (≠ S70), T96 (= T94), V121 (= V118), G123 (= G120), T124 (≠ A121), K171 (= K168), S231 (≠ T229), F232 (= F230), P233 (≠ T231), H236 (≠ L234), K239 (= K237)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
33% identity, 94% coverage: 1:270/288 of query aligns to 14:281/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (≠ R10), M24 (= M11), N43 (= N30), R44 (= R31), T45 (= T32), K48 (= K35), M76 (= M64), V77 (≠ L65), S78 (≠ A66), D82 (≠ S70), Q85 (≠ A73), V133 (= V118), F241 (= F230), K242 (≠ T231), H245 (≠ L234), K248 (= K237)
- binding sulfate ion: T134 (≠ S119), G135 (= G120), K183 (= K168)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
33% identity, 94% coverage: 1:270/288 of query aligns to 14:284/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (≠ R10), M24 (= M11), N43 (= N30), R44 (= R31), T45 (= T32), K48 (= K35), V77 (≠ L65), S78 (≠ A66), D82 (≠ S70), Q85 (≠ A73), V133 (= V118), F244 (= F230), K245 (≠ T231), H248 (≠ L234), K251 (= K237)
2uyyA Structure of the cytokine-like nuclear factor n-pac
28% identity, 97% coverage: 2:279/288 of query aligns to 8:286/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G9), L16 (≠ R10), M17 (= M11), N36 (= N30), R37 (= R31), T38 (= T32), V70 (≠ L65), S71 (≠ A66), A75 (≠ S70), T101 (= T94), F237 (= F230), Y238 (≠ T231), Y241 (≠ L234), K244 (= K237)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
28% identity, 97% coverage: 2:279/288 of query aligns to 269:547/553 of Q49A26
- 271:285 (vs. 4:18, 53% identical) binding
- T362 (= T94) binding
- M437 (≠ K168) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (vs. gap) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K237) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
28% identity, 97% coverage: 2:279/288 of query aligns to 268:540/546 of Q922P9
- P489 (vs. gap) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
29% identity, 97% coverage: 2:279/288 of query aligns to 5:285/294 of 5je8B
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
30% identity, 99% coverage: 3:288/288 of query aligns to 41:334/335 of P29266
- D68 (≠ N30) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K168) mutation K->A,H,N,R: Complete loss of activity.
- N212 (= N172) mutation to Q: Decrease in activity.
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
26% identity, 98% coverage: 4:284/288 of query aligns to 319:599/602 of Q8T079
Sites not aligning to the query:
- 8 modified: Phosphoserine
- 10 modified: Phosphoserine
- 224 modified: Phosphoserine
- 228 modified: Phosphoserine
- 243 modified: Phosphoserine
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
29% identity, 98% coverage: 3:284/288 of query aligns to 4:287/298 of P0A9V8
- QM 11:12 (≠ RM 10:11) binding
- D31 (≠ N30) binding
- L65 (= L65) binding
- T96 (= T94) binding
- G122 (≠ S119) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G120) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ A121) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ VNALI 171:175) binding
- K240 (= K237) binding
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
29% identity, 98% coverage: 3:284/288 of query aligns to 3:286/294 of 6smyA
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
29% identity, 98% coverage: 3:284/288 of query aligns to 3:286/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), Q10 (≠ R10), M11 (= M11), F29 (≠ W29), D30 (≠ N30), V31 (≠ R31), M63 (= M64), L64 (= L65), V73 (= V74), S94 (≠ G93), T95 (= T94), R122 (≠ G120)
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
28% identity, 100% coverage: 1:288/288 of query aligns to 1:296/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), N10 (≠ R10), M11 (= M11), Y29 (≠ W29), D30 (≠ N30), V31 (≠ R31), M63 (= M64), L64 (= L65), P65 (≠ A66), T95 (= T94), V120 (= V118), G122 (= G120), F238 (= F230), K245 (= K237)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
28% identity, 99% coverage: 3:288/288 of query aligns to 42:335/336 of P31937
- LP 103:104 (≠ LA 65:66) binding
- N108 (≠ S70) binding
- T134 (= T94) binding
- K284 (= K237) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
7puaFM uS11m (see paper)
30% identity, 77% coverage: 1:222/288 of query aligns to 6:242/327 of 7puaFM
Sites not aligning to the query:
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
28% identity, 97% coverage: 2:279/288 of query aligns to 3:287/295 of 3obbA
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
27% identity, 97% coverage: 2:279/288 of query aligns to 3:288/298 of Q9I5I6
- P66 (≠ A66) binding
- T96 (= T94) binding ; mutation to A: Almost abolished activity.
- S122 (= S119) mutation to A: Strongly reduced activity.
- K171 (= K168) active site
- N175 (= N172) mutation to A: Strongly reduced activity.
- W214 (≠ P211) mutation to A: Almost abolished activity.
- Y219 (≠ R216) mutation to A: Strongly reduced activity.
- K246 (= K237) binding ; mutation to A: Almost abolished activity.
- D247 (= D238) mutation to A: Almost abolished activity.
Sites not aligning to the query:
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
28% identity, 97% coverage: 2:279/288 of query aligns to 2:286/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), H10 (≠ R10), M11 (= M11), F29 (≠ W29), D30 (≠ N30), L31 (≠ R31), M63 (= M64), L64 (= L65), P65 (= P69), T94 (= T94), V119 (= V118), G121 (= G120), F237 (= F230), K244 (= K237)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
27% identity, 93% coverage: 2:269/288 of query aligns to 3:266/289 of 2cvzC
- active site: S117 (= S119), K165 (= K168), N168 (≠ V171), N169 (= N172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), L9 (= L8), G10 (= G9), A11 (≠ R10), M12 (= M11), N30 (= N30), R31 (= R31), T32 (= T32), C62 (≠ M64), L63 (= L65), P64 (= P69), E68 (≠ A73), E71 (≠ A76), S91 (≠ T94), V116 (= V118), F227 (= F230), K234 (= K237)
Query Sequence
>GFF2273 FitnessBrowser__Phaeo:GFF2273
MRVGFVGLGRMGAHLARNLARSGHDLTLWNRTRNKAEALANELSCDVADSPRALSDAADV
VVTMLADDPSSKAVHAGEDGLFAGSTDTFIEMGTMSPDHIAWLAQQAPAGARVIDAPVSG
ATQAAADAQLLIMAGSAPDEAATLSALFDAMGKQTIYLGETGRGAVMKLSVNALIHGINQ
TLAEAMTLAEASGIEPETAFDVIEASAACAPMLKYRRPIYLDEAAHDVTFTVALARKDME
VTVDLARKLGTQMPQGRSTLEILQKAESDGYSARDMASILNFMRGHNT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory