Comparing GFF2274 FitnessBrowser__Phaeo:GFF2274 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
46% identity, 97% coverage: 7:496/503 of query aligns to 4:493/501 of P04983
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 43% coverage: 7:221/503 of query aligns to 4:227/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 43% coverage: 7:221/503 of query aligns to 4:227/254 of 1g6hA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 43% coverage: 6:221/503 of query aligns to 1:213/241 of 4u00A
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 46% coverage: 10:242/503 of query aligns to 14:246/265 of P07821
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
32% identity, 43% coverage: 7:221/503 of query aligns to 4:220/650 of 5ws4A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 46% coverage: 5:234/503 of query aligns to 15:238/378 of P69874
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
30% identity, 41% coverage: 271:476/503 of query aligns to 22:220/226 of 5xu1B
6mbnA Lptb e163q in complex with atp (see paper)
28% identity, 48% coverage: 5:247/503 of query aligns to 1:241/241 of 6mbnA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
29% identity, 42% coverage: 274:485/503 of query aligns to 44:250/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
29% identity, 42% coverage: 274:485/503 of query aligns to 44:250/382 of 7aheC
Sites not aligning to the query:
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
29% identity, 44% coverage: 7:227/503 of query aligns to 3:221/223 of 2pclA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
26% identity, 48% coverage: 7:247/503 of query aligns to 2:240/240 of 6mjpA
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
29% identity, 43% coverage: 8:221/503 of query aligns to 7:206/353 of 1vciA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 47% coverage: 8:242/503 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 47% coverage: 8:242/503 of query aligns to 3:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 47% coverage: 8:242/503 of query aligns to 3:235/235 of 6mhzA
7ahdC Opua (e190q) occluded (see paper)
28% identity, 42% coverage: 274:485/503 of query aligns to 44:250/260 of 7ahdC
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 44% coverage: 267:485/503 of query aligns to 10:223/240 of 4ymuJ
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
30% identity, 43% coverage: 7:221/503 of query aligns to 4:213/285 of 4yerA
>GFF2274 FitnessBrowser__Phaeo:GFF2274
MTEQSPVLRLEGIVKTFPGVRALDGVSLTILPGEVHALMGENGAGKSTLMKVLGGIHQPD
EGQIIVAEQPVVMSGPLDAKAKGIVFIHQELSLADELSVAENIYLGELPRKRFGLVDWAE
LEAKTNAILEKLKVGFNAKTRVGDLSIANQQMVEIARALTVDAKAVIFDEPTASLTDAEK
VVLFEVISDLQEQGVGIAYISHRMEEIFKITDRISVLRDGQYQGTVNTAETNEENVTQMM
IGRKLDLSRNEAHHELGEVALEVRGLSCGSLFEDVNFEVRRGEVVGFYGLVGAGRTEIAE
TLFGLRNPTSGSIFLDGAEVAITSPHDAIERGISLVPEDRKGQGLVLGMNCRDNMTLPQV
DDLKAGPFVADGAEIAIFDQYRDKLDIRTPGWKQLVGNLSGGNQQKIVIGKWLSMRPNVL
IVDEPTRGIDVGSKAEIHNLLRDLAAQGYAVIVISSEMPEVLHVADRIVAMYSGRIMRTF
TSEEVTEENLIAAISGLDTEKVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory