SitesBLAST
Comparing GFF2280 FitnessBrowser__Phaeo:GFF2280 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6pejA Structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol
36% identity, 97% coverage: 4:265/269 of query aligns to 2:253/257 of 6pejA
3wyeA Crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with NAD+
38% identity, 96% coverage: 9:265/269 of query aligns to 2:251/255 of 3wyeA
- active site: G12 (= G19), S138 (= S150), Y151 (= Y163), K155 (= K167), L196 (= L208)
- binding nicotinamide-adenine-dinucleotide: G8 (= G15), Q11 (≠ R18), G12 (= G19), I13 (≠ M20), D32 (= D39), Y33 (≠ L40), V57 (≠ M65), D58 (= D66), V59 (= V67), N85 (= N93), A86 (= A94), S138 (= S150), Y151 (= Y163), K155 (= K167), P181 (= P193), G182 (= G194), V184 (= V196), T186 (= T198), M188 (≠ L200), W189 (= W201)
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
37% identity, 96% coverage: 9:265/269 of query aligns to 3:252/256 of 1gegE
- active site: G13 (= G19), S139 (= S150), Y152 (= Y163), K156 (= K167), V197 (≠ L208)
- binding alpha-D-glucopyranose: R63 (= R70), D64 (≠ A71), F67 (≠ A74), E123 (≠ R130)
- binding nicotinamide-adenine-dinucleotide: G9 (= G15), Q12 (≠ R18), I14 (≠ M20), D33 (= D39), Y34 (≠ L40), V58 (≠ M65), D59 (= D66), V60 (= V67), N86 (= N93), A87 (= A94), I109 (≠ V116), S139 (= S150), Y152 (= Y163), K156 (= K167), P182 (= P193), V185 (= V196), T187 (= T198), M189 (≠ L200)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
37% identity, 96% coverage: 9:265/269 of query aligns to 3:252/256 of Q48436
- 6:33 (vs. 12:39, 39% identical) binding
- D59 (= D66) binding
- K156 (= K167) binding
3a28C Crystal structure of l-2,3-butanediol dehydrogenase (see paper)
34% identity, 96% coverage: 9:265/269 of query aligns to 2:253/257 of 3a28C
- active site: G12 (= G19), S140 (= S150), Y153 (= Y163), K157 (= K167), L198 (= L208)
- binding nicotinamide-adenine-dinucleotide: G8 (= G15), Q11 (≠ R18), I13 (≠ M20), D32 (= D39), L33 (= L40), Q36 (≠ D43), L59 (≠ M65), D60 (= D66), V61 (= V67), N87 (= N93), S140 (= S150), Y153 (= Y163), K157 (= K167), P183 (= P193), V186 (= V196), T188 (= T198), M190 (≠ L200), W191 (= W201)
Q9ZNN8 L-2,3-butanediol dehydrogenase; L-BDH; (S,S)-butanediol dehydrogenase; Diacetyl reductase [(S)-acetoin forming]; EC 1.1.1.76; EC 1.1.1.304 from Corynebacterium glutamicum (Brevibacterium saccharolyticum) (see paper)
34% identity, 96% coverage: 9:265/269 of query aligns to 3:254/258 of Q9ZNN8
- QGI 12:14 (≠ RGM 18:20) binding
- D33 (= D39) binding
- Q37 (≠ D43) binding
- DV 61:62 (= DV 66:67) binding
- N88 (= N93) binding
- I142 (= I151) mutation to Q: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with N-148.; mutation to Q: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- F148 (≠ L157) mutation to N: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with Q-142.; mutation to N: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- Y154 (= Y163) binding
- K158 (= K167) binding
- PGIVGT 184:189 (≠ PGVVVT 193:198) binding
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
33% identity, 97% coverage: 6:265/269 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ R18) binding
- D36 (= D39) binding
- D62 (= D66) binding
- I63 (≠ V67) binding
- N89 (= N93) binding
- Y153 (= Y163) binding
- K157 (= K167) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
33% identity, 97% coverage: 6:265/269 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), M16 (= M20), D35 (= D39), I36 (≠ L40), I62 (≠ V67), N88 (= N93), G90 (= G95), I138 (= I151), S140 (= S153), Y152 (= Y163), K156 (= K167), I185 (≠ V196)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 97% coverage: 6:266/269 of query aligns to 5:252/255 of 5itvA
- active site: G18 (= G19), S141 (= S150), Y154 (= Y163), K158 (= K167)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G15), S17 (≠ R18), G18 (= G19), I19 (≠ M20), D38 (= D39), I39 (≠ L40), T61 (≠ M65), I63 (≠ V67), N89 (= N93), G91 (= G95), T139 (≠ V148), S141 (= S150), Y154 (= Y163), K158 (= K167), P184 (= P193), G185 (= G194), I186 (≠ V195), I187 (≠ V196)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
34% identity, 96% coverage: 9:266/269 of query aligns to 6:251/256 of 7do7A
- active site: G16 (= G19), S146 (= S150), Y159 (= Y163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), R15 (= R18), G16 (= G19), I17 (≠ M20), S37 (≠ L40), D66 (= D66), A67 (≠ V67), N93 (= N93), A94 (= A94), G95 (= G95), I96 (≠ L96), V144 (= V148), S145 (≠ G149), S146 (= S150), Y159 (= Y163), K163 (= K167), P189 (= P193), G190 (= G194), I192 (≠ V196), T194 (= T198), I196 (≠ L200)
- binding beta-L-rhamnopyranose: F99 (≠ P99), S146 (= S150), S148 (≠ A152), Q156 (≠ V160), Y159 (= Y163), N197 (≠ W201), D235 (= D250), M236 (≠ D251), R238 (≠ D253)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
34% identity, 96% coverage: 9:266/269 of query aligns to 6:251/256 of 7b81A
- active site: G16 (= G19), S146 (= S150), Y159 (= Y163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), S14 (≠ A17), R15 (= R18), I17 (≠ M20), D66 (= D66), A67 (≠ V67), N93 (= N93), A94 (= A94), G95 (= G95), I96 (≠ L96), T116 (≠ V116), V144 (= V148), S146 (= S150), Y159 (= Y163), K163 (= K167), P189 (= P193), G190 (= G194), I192 (≠ V196), T194 (= T198), I196 (≠ L200)
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
31% identity, 98% coverage: 4:266/269 of query aligns to 4:249/251 of 4cqlI
- active site: G19 (= G19), S146 (= S150), Y159 (= Y163), K163 (= K167)
- binding nicotinamide-adenine-dinucleotide: S18 (≠ R18), G19 (= G19), I20 (≠ M20), D39 (= D39), L40 (= L40), A64 (≠ M65), D65 (= D66), V66 (= V67), C93 (≠ N93), A94 (= A94), G95 (= G95), I96 (≠ L96), V116 (= V116), I144 (≠ V148), S146 (= S150), Y159 (= Y163), K163 (= K167), P189 (= P193), G190 (= G194), I192 (≠ V196), T194 (= T198), M196 (≠ L200)
4cqmA Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
31% identity, 98% coverage: 4:266/269 of query aligns to 2:246/248 of 4cqmA
- active site: G17 (= G19), S143 (= S150), Y156 (= Y163), K160 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G15), S16 (≠ R18), G17 (= G19), I18 (≠ M20), D37 (= D39), L38 (= L40), A61 (≠ M65), V63 (= V67), C90 (≠ N93), A91 (= A94), G92 (= G95), I93 (≠ L96), V113 (= V116), I141 (≠ V148), S143 (= S150), Y156 (= Y163), K160 (= K167), P186 (= P193), G187 (= G194), I189 (≠ V196), T191 (= T198), P192 (= P199), M193 (≠ L200), T194 (≠ W201)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
31% identity, 97% coverage: 6:266/269 of query aligns to 8:244/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G15), D19 (≠ A17), L22 (≠ M20), I42 (≠ G42), D65 (= D66), M66 (≠ V67), N92 (= N93), A93 (= A94), G94 (= G95), L115 (≠ V116), I143 (≠ V148), S145 (= S150), Y158 (= Y163), K162 (= K167), G189 (= G194), M191 (≠ V196), T193 (= T198), N195 (≠ L200)
5ojiA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
32% identity, 97% coverage: 4:265/269 of query aligns to 6:255/260 of 5ojiA
- active site: G21 (= G19), S148 (≠ G149), Y161 (= Y163), K165 (= K167)
- binding isatin: S148 (≠ G149), S150 (≠ I151), Y161 (= Y163), V193 (= V195), S199 (vs. gap), L202 (= L200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G15), T19 (≠ A17), I22 (≠ M20), S41 (≠ D39), R42 (≠ L40), N43 (≠ D41), N46 (≠ E44), I69 (≠ V67), N95 (= N93), H96 (≠ A94), G97 (= G95), N146 (= N147), S148 (≠ G149), Y161 (= Y163), K165 (= K167), G192 (= G194), I194 (≠ V196), T196 (= T198), M198 (vs. gap)
5ojgA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
32% identity, 97% coverage: 4:265/269 of query aligns to 6:255/260 of 5ojgA
- active site: G21 (= G19), S148 (≠ G149), Y161 (= Y163), K165 (= K167)
- binding butane-2,3-dione: S148 (≠ G149), Y161 (= Y163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G15), T19 (≠ A17), G21 (= G19), I22 (≠ M20), S41 (≠ D39), R42 (≠ L40), N43 (≠ D41), N46 (≠ E44), I69 (≠ V67), N95 (= N93), H96 (≠ A94), G97 (= G95), N146 (= N147), S148 (≠ G149), Y161 (= Y163), K165 (= K167), P191 (= P193), I194 (≠ V196), T196 (= T198), M198 (vs. gap)
Q92506 (3R)-3-hydroxyacyl-CoA dehydrogenase; 17-beta-hydroxysteroid dehydrogenase 8; 17-beta-HSD 8; HSD17B8; 3-ketoacyl-[acyl-carrier-protein] reductase alpha subunit; KAR alpha subunit; 3-oxoacyl-[acyl-carrier-protein] reductase; Estradiol 17-beta-dehydrogenase 8; Protein Ke6; Ke6; Short chain dehydrogenase/reductase family 30C member 1; Testosterone 17-beta-dehydrogenase 8; EC 1.1.1.n12; EC 1.1.1.62; EC 1.1.1.239 from Homo sapiens (Human) (see 2 papers)
31% identity, 98% coverage: 4:266/269 of query aligns to 7:259/261 of Q92506
- 15:23 (vs. 12:20, 56% identical) binding
- D42 (= D39) mutation to A: Reduced NADH-dependent reductase activity with acetoacetyl-CoA. Reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Increases NADPH-dependent reductase activities. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- DL 42:43 (= DL 39:40) binding
- ADV 74:76 (≠ MDV 65:67) binding
- R148 (≠ M138) mutation to E: No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- V158 (≠ A152) to L: in a breast cancer sample; somatic mutation
- Y169 (= Y163) mutation to A: Strongly reduced NADH-dependent reductase activity with acetoacetyl-CoA. Strongly reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Decreases NADPH-dependent reductase activity with acetoacetyl-CoA, but increases NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- YAASK 169:173 (≠ YCTSK 163:167) binding
- K173 (= K167) mutation to A: Abolishes NADH-dependent reductase activity with acetoacetyl-CoA. Strongly reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Slightly decreases NADPH-dependent reductase activity with acetoacetyl-CoA, but increases NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- R189 (≠ E183) mutation to E: No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- IAT 202:204 (≠ VVT 196:198) binding
6zzpA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and 3-oxovalerate (see paper)
33% identity, 97% coverage: 6:266/269 of query aligns to 8:262/265 of 6zzpA
- binding nicotinamide-adenine-dinucleotide: G17 (= G15), S20 (≠ R18), G21 (= G19), I22 (≠ M20), D41 (= D39), I42 (≠ L40), M66 (= M65), D67 (= D66), V68 (= V67), N94 (= N93), A95 (= A94), G96 (= G95), M145 (≠ V148), S147 (= S150), Y160 (= Y163), K164 (= K167), P190 (= P193), F192 (≠ V195), V193 (= V196), T195 (= T198), L197 (= L200), V198 (≠ W201)
- binding 3-oxidanylidenepentanoic acid: Q98 (≠ N97), S147 (= S150), H149 (≠ A152), K157 (≠ V160), Y160 (= Y163), F192 (≠ V195), Q201 (= Q203)
6zzoC Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and acetoacetate (see paper)
33% identity, 97% coverage: 6:266/269 of query aligns to 8:262/265 of 6zzoC
- binding acetoacetic acid: Q98 (≠ N97), H149 (≠ A152), K157 (≠ V160), F192 (≠ V195), Q201 (= Q203)
- binding nicotinamide-adenine-dinucleotide: G17 (= G15), S20 (≠ R18), G21 (= G19), I22 (≠ M20), D41 (= D39), I42 (≠ L40), M66 (= M65), D67 (= D66), V68 (= V67), N94 (= N93), A95 (= A94), G96 (= G95), M145 (≠ V148), Y160 (= Y163), K164 (= K167), P190 (= P193), F192 (≠ V195), V193 (= V196), T195 (= T198), L197 (= L200), V198 (≠ W201)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
31% identity, 97% coverage: 6:265/269 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G19), S142 (= S150), Q152 (≠ V160), Y155 (= Y163), K159 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (≠ A17), R15 (= R18), G16 (= G19), I17 (≠ M20), N35 (≠ D39), Y36 (≠ L40), N37 (≠ D41), G38 (= G42), S39 (≠ D43), N63 (≠ D66), V64 (= V67), N90 (= N93), A91 (= A94), I93 (≠ L96), I113 (≠ V116), S142 (= S150), Y155 (= Y163), K159 (= K167), P185 (= P193), I188 (≠ V196), T190 (= T198)
Query Sequence
>GFF2280 FitnessBrowser__Phaeo:GFF2280
MDPNRLKGKNILITGAARGMGQANAESFAAQGANVCLGDLDGDEAQKVADAINAAGNGMA
IAVKMDVTSRADNAAAVAATVEAFGSINVGLFNAGLNKPRFFMDIDEDNWDMIMNVNTKA
MWLGMQEVARQMIAQGPMEDHPYKLINVGSIASKKPLVDVTVYCTSKYGCLALTECGALG
LAEHNITVNGYAPGVVVTPLWEQLDKDLVDIGFKEREGQAYEDIVDSALVIKRLSYPKDI
VGTASFLASDDSDYMTGQMISIDGGWATT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory