SitesBLAST
Comparing GFF2281 FitnessBrowser__WCS417:GFF2281 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
29% identity, 87% coverage: 40:415/434 of query aligns to 44:421/425 of O59010
- S65 (≠ T61) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A275) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 275:277) binding
- M311 (≠ L310) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T313) binding
- V355 (= V354) binding
- D394 (≠ S388) binding
- M395 (= M389) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (≠ I391) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N395) binding
- D405 (≠ N399) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
29% identity, 85% coverage: 40:408/434 of query aligns to 35:405/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
29% identity, 86% coverage: 40:411/434 of query aligns to 36:409/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
29% identity, 85% coverage: 40:408/434 of query aligns to 36:406/408 of 6bauA
- binding cysteine: S270 (= S277), M303 (≠ L310), T306 (= T313), A345 (= A352), G346 (≠ A353), V347 (= V354), G351 (≠ S358), D386 (≠ S388), C389 (≠ I391), T390 (≠ A392), N393 (= N395)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
28% identity, 86% coverage: 40:413/434 of query aligns to 44:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L42), F46 (≠ L42), P75 (≠ D71), L91 (≠ V88), F95 (≠ I92), L130 (≠ T136), I133 (≠ F139), I159 (≠ V165), Y167 (≠ A173), K196 (≠ E195), G200 (≠ L199), I207 (≠ L206), F210 (= F209), L250 (≠ V249), I262 (≠ L261), M269 (≠ I268), T334 (≠ S333), V335 (≠ W334), G336 (≠ E335), T340 (≠ G339), L343 (≠ A342), M399 (≠ T393)
- binding aspartic acid: S277 (= S276), S278 (= S277), T314 (= T313), G354 (≠ A353), A358 (≠ G357), G359 (≠ S358), D394 (≠ S388), R397 (≠ I391), T398 (≠ A392)
- binding sodium ion: Y89 (≠ F86), T92 (≠ V89), S93 (= S90), G306 (= G305), T308 (≠ A307), N310 (= N309), N310 (= N309), M311 (≠ L310), D312 (= D311), S349 (= S348), I350 (≠ K349), T352 (≠ A351), N401 (= N395), V402 (≠ T396), D405 (≠ N399)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
28% identity, 85% coverage: 40:408/434 of query aligns to 41:411/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G65), V83 (≠ L83), I157 (≠ L166), Y164 (≠ A173), K193 (≠ E195), T305 (≠ A307), I306 (≠ F308), I347 (≠ K349)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: M199 (= M201), S275 (= S277), T311 (= T313), G356 (≠ S358), L384 (≠ F381), D391 (≠ S388), R394 (≠ I391)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
27% identity, 94% coverage: 7:416/434 of query aligns to 3:422/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
27% identity, 94% coverage: 7:416/434 of query aligns to 3:422/427 of 5e9sA
- binding aspartic acid: R274 (≠ A275), S275 (= S276), S276 (= S277), T313 (= T313), G353 (≠ A353), V354 (= V354), A357 (≠ G357), G358 (≠ S358), D394 (≠ S388), R397 (≠ I391), T398 (≠ A392)
- binding decyl-beta-d-maltopyranoside: L194 (≠ E195), G198 (≠ L199), Y202 (≠ F203)
- binding sodium ion: Y87 (≠ F86), T90 (≠ V89), S91 (= S90), S276 (= S277), G305 (= G305), A306 (≠ Y306), T307 (≠ A307), N309 (= N309), N309 (= N309), M310 (≠ L310), D311 (= D311), S348 (= S348), I349 (≠ K349), G350 (= G350), T351 (≠ A351), N401 (= N395), V402 (≠ T396), D405 (≠ N399)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
27% identity, 94% coverage: 7:416/434 of query aligns to 1:420/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
27% identity, 92% coverage: 16:416/434 of query aligns to 9:419/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ E195), G195 (≠ L199), R282 (≠ Q286)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A275), S272 (= S276), S273 (= S277), M307 (≠ L310), T310 (= T313), G353 (= G356), A354 (≠ G357), R394 (≠ I391), T395 (≠ A392)
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
28% identity, 85% coverage: 40:408/434 of query aligns to 36:394/396 of 6bmiA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
27% identity, 92% coverage: 16:416/434 of query aligns to 5:411/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A275), S265 (= S277), M299 (≠ L310), T302 (= T313), T340 (≠ A351), G342 (≠ A353), V343 (= V354), G347 (≠ S358), D383 (≠ S388), R386 (≠ I391), T387 (≠ A392), N390 (= N395)
- binding decyl-beta-d-maltopyranoside: H23 (≠ E34), V212 (≠ L224), A216 (= A228)
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
26% identity, 91% coverage: 25:419/434 of query aligns to 33:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V75), G89 (= G76), G92 (= G79), A95 (= A82), V96 (≠ L83), Y99 (≠ F86), M163 (≠ V165), F167 (= F169), F293 (≠ L300), V297 (≠ T304)
- binding aspartic acid: S268 (= S276), S269 (= S277), T306 (= T313), G346 (≠ A353), I347 (≠ V354), A350 (≠ G357), G351 (≠ S358), D380 (≠ S388), R383 (≠ I391), T384 (≠ A392)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
26% identity, 91% coverage: 25:418/434 of query aligns to 25:397/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I66), S80 (≠ V75), G81 (= G76), G84 (= G79), Y91 (≠ F86), M156 (≠ V165), F160 (= F169), F286 (≠ L300), V290 (≠ T304)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V58), I148 (≠ L157), S262 (= S277), S263 (≠ E278), A292 (≠ Y306), T293 (≠ A307), M296 (≠ L310), T299 (= T313), G329 (= G350), A336 (≠ G357), G337 (≠ S358), D366 (≠ S388), R369 (≠ I391), N373 (= N395)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
26% identity, 85% coverage: 33:400/434 of query aligns to 37:404/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S276), S281 (= S277), T318 (= T313), G363 (≠ S358), M367 (≠ F362), V385 (≠ F381), D388 (≠ Y384), R395 (≠ I391), T396 (≠ A392)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R385)
- binding cholesterol hemisuccinate: R80 (≠ K77), R84 (= R81), I95 (= I92), I252 (≠ V245)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
26% identity, 85% coverage: 33:400/434 of query aligns to 36:405/425 of 7xr4A
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
26% identity, 85% coverage: 33:400/434 of query aligns to 29:389/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ T61), L58 (≠ V62), L65 (≠ A69), V339 (≠ K349), G340 (= G350), S343 (≠ A353), I344 (≠ V354)
- binding cholesterol: W188 (≠ K202), I227 (vs. gap), F250 (≠ L261), W257 (≠ I268), M379 (≠ A390), S382 (≠ T393)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S277), M300 (≠ L310), T303 (= T313), Y306 (= Y316), G348 (≠ S358), L349 (≠ F359), M352 (≠ F362), I366 (≠ L377), L369 (= L380), V370 (≠ F381), D373 (≠ Y384), D377 (≠ S388), R380 (≠ I391), T381 (≠ A392), N384 (= N395)
Sites not aligning to the query:
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
25% identity, 86% coverage: 39:410/434 of query aligns to 81:498/543 of P56564
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
25% identity, 86% coverage: 39:410/434 of query aligns to 81:498/542 of P43003
- S363 (≠ A275) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ ASS 275:277) binding
- T396 (≠ A307) binding
- T402 (= T313) binding
- IPQAG 443:447 (≠ VSGGS 354:358) binding
- D476 (≠ S388) binding
- R477 (≠ M389) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N395) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
24% identity, 88% coverage: 43:424/434 of query aligns to 82:511/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
Query Sequence
>GFF2281 FitnessBrowser__WCS417:GFF2281
MSSTTAKKPLYKDLTFQVIAAMFLGIAFGFLAPELAAGFKILGDIFLKLIKTAVAPLVFF
TVVHGIASAGDIKRVGKVGLRALIYFEVVSTIALAIGLLWGNLLQIGSGMHDAHPSSAAA
TAASAAVAKGHAPASTLDFIYGIFPDNFVGAFAGGQLLQVLVISVLFGFALLALKPERRE
VIEDGLNRISECFFEFINLIMKFAPLGAFGSVAYAVGSNGTAVLMSLANLVLMFYVGIAF
FICVVLGAVCRLSGFSLWRFLTYIKDEIFIVLGTASSESALPRLLQKLEKFGCSKQSVGL
VLPTGYAFNLDGTSIYMSLCVLFIANAYGVPLSWEQQLGIIAIMLVTSKGAAAVSGGSFV
VFAATVTAIGVLPAEGLALLFGVYRFMSMAIATCNTIGNSVATVVVSKWSGEFSQQTAQD
EYQRVLGRAAGAAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory