Comparing GFF2283 FitnessBrowser__Phaeo:GFF2283 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 6 papers)
47% identity, 93% coverage: 3:310/331 of query aligns to 32:344/359 of P11177
Sites not aligning to the query:
6cerD Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
45% identity, 97% coverage: 3:324/331 of query aligns to 4:330/331 of 6cerD
6cfoB Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
45% identity, 97% coverage: 3:324/331 of query aligns to 3:329/330 of 6cfoB
3dv0D Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
46% identity, 97% coverage: 3:324/331 of query aligns to 2:323/324 of 3dv0D
3dv0B Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
46% identity, 97% coverage: 3:324/331 of query aligns to 2:323/324 of 3dv0B
3dufD Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
46% identity, 97% coverage: 3:324/331 of query aligns to 2:323/324 of 3dufD
1w85B The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
46% identity, 97% coverage: 3:324/331 of query aligns to 2:323/324 of 1w85B
Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
43% identity, 94% coverage: 1:311/331 of query aligns to 1:310/324 of Q5SLR3
1umdD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
44% identity, 93% coverage: 4:311/331 of query aligns to 3:309/323 of 1umdD
1umcD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
44% identity, 93% coverage: 4:311/331 of query aligns to 3:309/323 of 1umcD
1umbD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
44% identity, 93% coverage: 4:311/331 of query aligns to 3:309/323 of 1umbD
1qs0B Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
37% identity, 97% coverage: 4:323/331 of query aligns to 5:336/338 of 1qs0B
2j9fD Human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b (see paper)
37% identity, 98% coverage: 2:324/331 of query aligns to 6:328/329 of 2j9fD
1dtwB Human branched-chain alpha-keto acid dehydrogenase (see paper)
37% identity, 98% coverage: 2:324/331 of query aligns to 3:325/326 of 1dtwB
P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Homo sapiens (Human) (see 2 papers)
37% identity, 98% coverage: 2:324/331 of query aligns to 69:391/392 of P21953
Q9RUB5 1-deoxy-D-xylulose-5-phosphate synthase; 1-deoxyxylulose-5-phosphate synthase; DXP synthase; DXPS; EC 2.2.1.7 from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) (see paper)
26% identity, 82% coverage: 5:277/331 of query aligns to 323:577/629 of Q9RUB5
Sites not aligning to the query:
6xxgAAA 1-deoxy-D-xylulose-5-phosphate synthase,1-deoxy-D-xylulose-5-phosphate synthase (see paper)
25% identity, 90% coverage: 5:301/331 of query aligns to 257:529/560 of 6xxgAAA
Sites not aligning to the query:
2o1xA 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from deinococcus radiodurans (see paper)
26% identity, 82% coverage: 5:277/331 of query aligns to 274:528/578 of 2o1xA
Sites not aligning to the query:
6ouvA 1-deoxy-d-xylulose 5-phosphate synthase (dxps) from deinococcus radiodurans with methylacetylphosphonate (map) bound (see paper)
26% identity, 82% coverage: 5:277/331 of query aligns to 289:543/595 of 6ouvA
Sites not aligning to the query:
6ouwA 1-deoxy-d-xylulose 5-phosphate synthase (dxps) from deinococcus radiodurans with enamine intermediate bound (see paper)
26% identity, 82% coverage: 5:277/331 of query aligns to 241:495/544 of 6ouwA
Sites not aligning to the query:
>GFF2283 FitnessBrowser__Phaeo:GFF2283
MREITLSQAVNEALAEEMRRDETVFIIGEDVAEAGTPFKVLSGLVEEFGTERVVDTPIAE
PGFMGLAVGAAMTGTRPVVDLMFGDFIYLIMDQLCNQAAKTHYMSGGKMSAPLVLRTNMG
ATRRSAAQHSQSLHALVAHIPGLKVAMPSSAYEAKGLMKTAIRDNNPVVIFEDKLMYNDK
APVPEEEFLIPFGEANIKRAGNDITLIATSSMVQVCEAAAEILAKEGIDAEVIDPRTIVP
LDEETLIASAKKTSRVIVVDEGHQSYGITGEIAGRINEKAFYHLDAPVLRMGAMDVPVPF
SPALEDITVPTPEAVAANARKLMSGEMIHAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory