SitesBLAST
Comparing GFF2298 FitnessBrowser__Phaeo:GFF2298 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
39% identity, 100% coverage: 4:814/815 of query aligns to 22:823/824 of Q8GAI3
- W66 (≠ F48) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (= H49) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
37% identity, 94% coverage: 2:771/815 of query aligns to 44:818/866 of Q9UI17
- CV 59:60 (≠ II 17:18) binding
- EK 80:81 (≠ ER 38:39) binding
- 87:95 (vs. 45:53, 78% identical) binding
- H91 (= H49) modified: Tele-8alpha-FAD histidine
- H109 (≠ L67) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V177) binding
- S279 (≠ E237) to P: in dbSNP:rs532964
- F-GYGII 397:402 (≠ FNAFGIA 347:353) binding
- A530 (≠ V484) to G: in dbSNP:rs1805073
- S646 (≠ R600) to P: in dbSNP:rs1805074
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
35% identity, 99% coverage: 8:814/815 of query aligns to 43:851/857 of Q63342
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
35% identity, 100% coverage: 3:814/815 of query aligns to 1:814/824 of 4pabB
- active site: T53 (≠ G55), E102 (= E104), H226 (= H228), Y255 (= Y254), E536 (≠ D535)
- binding flavin-adenine dinucleotide: I11 (= I13), G12 (= G14), G14 (= G16), C15 (≠ I17), V16 (≠ I18), L35 (= L37), E36 (= E38), K37 (≠ R39), G43 (= G45), S44 (≠ T46), T45 (= T47), H47 (= H49), A48 (= A50), A49 (= A51), G50 (= G52), L51 (= L53), V175 (= V177), A204 (= A206), G205 (= G207), W207 (= W209), H226 (= H228), Y228 (= Y230), G326 (= G320), I328 (≠ E322), F353 (= F347), Y355 (≠ F350), G356 (= G351), I357 (= I352), I358 (≠ A353)
- binding (6s)-5,6,7,8-tetrahydrofolate: I523 (≠ Y522), E536 (≠ D535), T538 (= T537), I550 (≠ V549), F612 (= F610), L613 (≠ G611), Y632 (= Y630), E639 (= E637), F680 (≠ Y678), Y700 (≠ W698)
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
34% identity, 100% coverage: 4:814/815 of query aligns to 1:829/830 of Q9AGP8
- IV 14:15 (≠ II 17:18) binding
- DQ 35:36 (≠ ER 38:39) binding
- STSH 45:48 (≠ TTFH 46:49) binding
- L52 (= L53) binding
- V174 (= V177) binding
- H225 (= H228) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (= Y254) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- VWVT 360:363 (≠ FGIA 350:353) binding
- Y539 (= Y522) binding
- D552 (= D535) Important for catalytic activity; mutation to A: No effect on the activity.; mutation to N: Reduces activity 3-fold.
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
34% identity, 99% coverage: 6:814/815 of query aligns to 1:827/828 of 1pj6A
- active site: H223 (= H228), Y257 (= Y254), D550 (= D535)
- binding flavin-adenine dinucleotide: G9 (= G14), G11 (= G16), I12 (= I17), V13 (≠ I18), D33 (≠ E38), Q34 (≠ R39), G42 (= G45), S43 (≠ T46), T44 (= T47), H46 (= H49), P48 (≠ A51), L50 (= L53), V172 (= V177), A201 (= A206), G202 (= G207), W204 (= W209), H223 (= H228), Y257 (= Y254), G331 (= G320), I332 (≠ P321), V358 (≠ F350), W359 (≠ G351), V360 (≠ I352), T361 (≠ A353)
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
34% identity, 99% coverage: 7:814/815 of query aligns to 1:826/827 of 1pj7A
- active site: H222 (= H228), Y256 (= Y254), D549 (= D535)
- binding flavin-adenine dinucleotide: G8 (= G14), G10 (= G16), I11 (= I17), V12 (≠ I18), D32 (≠ E38), Q33 (≠ R39), G41 (= G45), S42 (≠ T46), T43 (= T47), H45 (= H49), P47 (≠ A51), L49 (= L53), T170 (≠ K176), V171 (= V177), A200 (= A206), G201 (= G207), W203 (= W209), H222 (= H228), Y256 (= Y254), I331 (≠ P321), V357 (≠ F350), W358 (≠ G351), V359 (≠ I352), T360 (≠ A353)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: L505 (≠ F491), Y536 (= Y522), D549 (= D535), T551 (= T537), G563 (≠ V549), F629 (≠ G611), Y648 (= Y630), E655 (= E637), Y696 (= Y678)
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
34% identity, 99% coverage: 7:814/815 of query aligns to 1:826/827 of 3gsiA
- active site: H222 (= H228), Y256 (= Y254), A549 (≠ D535)
- binding flavin-adenine dinucleotide: G10 (= G16), I11 (= I17), V12 (≠ I18), D32 (≠ E38), Q33 (≠ R39), G41 (= G45), S42 (≠ T46), T43 (= T47), H45 (= H49), P47 (≠ A51), L49 (= L53), T170 (≠ K176), V171 (= V177), A200 (= A206), G201 (= G207), W203 (= W209), H222 (= H228), Y256 (= Y254), G330 (= G320), I331 (≠ P321), F332 (≠ E322), V357 (≠ F350), W358 (≠ G351), V359 (≠ I352), T360 (≠ A353)
- binding magnesium ion: D254 (≠ L252), V409 (≠ G402)
- binding (6s)-5,6,7,8-tetrahydrofolate: L505 (≠ F491), Y536 (= Y522), T551 (= T537), G563 (≠ V549), F629 (≠ G611), Y648 (= Y630), E655 (= E637), Y696 (= Y678)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
29% identity, 43% coverage: 421:771/815 of query aligns to 2:326/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
29% identity, 43% coverage: 421:771/815 of query aligns to 2:326/362 of 1wopA
- active site: D96 (= D535)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: M51 (≠ F491), L55 (≠ T495), Y83 (= Y522), D96 (= D535), V98 (≠ T537), E106 (= E545), L108 (≠ Y547), V110 (= V549), N112 (≠ G551), I137 (= I577), E160 (≠ R600), Y168 (≠ F610), Y169 (≠ G611), K173 (≠ T615), S174 (≠ I616), I175 (≠ G617), E180 (≠ P622), T181 (≠ V623), Y188 (= Y630), E195 (= E637), M197 (≠ H639), R227 (≠ I669), Y236 (= Y678)
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
29% identity, 43% coverage: 421:771/815 of query aligns to 2:326/362 of 1wooA
- active site: D96 (= D535)
- binding (6s)-5,6,7,8-tetrahydrofolate: M51 (≠ F491), Y83 (= Y522), D96 (= D535), V98 (≠ T537), V110 (= V549), N112 (≠ G551), Y168 (≠ F610), Y169 (≠ G611), Y188 (= Y630), E195 (= E637), Y236 (= Y678)
Sites not aligning to the query:
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
31% identity, 45% coverage: 23:385/815 of query aligns to 20:370/374 of 1y56B
- active site: F44 (= F48), G47 (vs. gap), T48 (≠ A51), H224 (= H228), P239 (≠ L243), G305 (= G320), M338 (≠ A353)
- binding flavin-adenine dinucleotide: I33 (≠ L36), E34 (= E38), K35 (≠ R39), S42 (≠ T46), T43 (= T47), R45 (≠ H49), C46 (≠ A50), G47 (vs. gap), G49 (= G52), E170 (≠ K176), V171 (= V177), T200 (≠ A206), N201 (≠ G207), W203 (= W209), G305 (= G320), Y306 (≠ P321), Y307 (≠ E322), G334 (≠ A349), H335 (≠ F350), G336 (= G351), F337 (≠ I352), M338 (≠ A353)
- binding flavin mononucleotide: F44 (= F48), R45 (≠ H49), I260 (≠ M264), R301 (≠ T316), W303 (≠ T318)
Sites not aligning to the query:
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
27% identity, 44% coverage: 419:773/815 of query aligns to 575:930/967 of Q46337
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 139 G→A: Does not affect activity and binding of NAD(+).
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
27% identity, 49% coverage: 415:812/815 of query aligns to 569:962/965 of 2gagA
Sites not aligning to the query:
- active site: 350, 375
- binding flavin mononucleotide: 510, 511, 517, 521, 549, 551
- binding nicotinamide-adenine-dinucleotide: 134, 135, 137, 138, 139, 158, 159, 160, 165, 166, 204, 205, 249, 250, 295, 381, 417, 418, 423, 424, 425, 554
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
26% identity, 44% coverage: 419:773/815 of query aligns to 573:928/965 of Q50LF0
Sites not aligning to the query:
- 139 binding
- 158 binding
- 159 binding
- 160 binding
- 166 binding
- 205 binding
- 418 binding
- 423 binding
- 425 binding
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
26% identity, 44% coverage: 419:773/815 of query aligns to 572:927/963 of 3ad7A
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
26% identity, 44% coverage: 419:773/815 of query aligns to 572:927/963 of 1vrqA
- active site: D676 (= D535)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: L631 (≠ F491), Y663 (= Y522), G677 (≠ L536), H690 (≠ V549), I774 (≠ V628), F776 (≠ Y630), E783 (= E637), K822 (= K676), F824 (≠ Y678)
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
30% identity, 37% coverage: 475:777/815 of query aligns to 35:333/363 of 3a8iA
- active site: D97 (= D535)
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: M51 (≠ F491), Y84 (= Y522), D97 (= D535), I99 (≠ T537), V111 (= V549), N113 (≠ G551), F173 (≠ T615), Y188 (= Y630), E195 (= E637), R223 (= R667), M232 (≠ Y678), W252 (= W698)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
26% identity, 46% coverage: 12:382/815 of query aligns to 6:360/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I13), G8 (= G14), G10 (= G16), V11 (≠ I17), I12 (= I18), V30 (≠ L37), E31 (= E38), K32 (≠ R39), E38 (≠ G45), A39 (≠ T46), S40 (≠ T47), A43 (= A50), G45 (= G52), L46 (= L53), V171 (= V177), G200 (≠ A206), G201 (= G207), W203 (= W209), G298 (= G320), R300 (≠ T325), P301 (= P326), Y326 (≠ N348), R327 (≠ A349), N328 (≠ F350), G329 (= G351), I330 (= I352)
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
26% identity, 43% coverage: 421:771/815 of query aligns to 3:334/371 of 1wsvA
- active site: D98 (= D535)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: M53 (≠ F491), L85 (= L520), D98 (= D535), L99 (= L536), I100 (≠ T537), V112 (= V549), N114 (≠ G551), F173 (= F608), G193 (≠ T629), Y194 (= Y630), E201 (= E637), R230 (≠ I669), L239 (≠ Y678)
Sites not aligning to the query:
Query Sequence
>GFF2298 FitnessBrowser__Phaeo:GFF2298
MTELPSTAKAVIIGGGIIGCSTAYHLAKLGWTDTVLLERKKLTSGTTFHAAGLVGQLRSN
ANITQLLGYSVDLYNKIETETGLGTGWKMNGGLRLACNEERWTEVKRQATTAHSFGLEME
LLTPKEAQDLWPLMDISDVIGAAFMPTDGQANPSDITQALAKGARMAGAKIFEDTKVIDI
EIEDGRIRAVITEHGRIECEKVICCAGQWTRTFAKRFGVNVPLVPMEHQYMVTEPFEGVP
SNLPTLRDPDRLTYYKEEVGGLVMGGYEPNPIPWATDGIPKGFHYSLLDSNFDHFEQLME
QALGRVPALEHAGIKTLTNGPESFTPDGNFIIGEAPELSNFYVGAGFNAFGIAAGGGAGM
ALAEWVKNGEPPFDLWSADIRRFGRPHFDTDWIRTRTVEAYGKHYTMAWPHEEHDSGRPC
RKSPLYDTLKNKGACFGEKLGWERPNWFADATRGETPQDLYSFGRQNWFDAVGREHKAAR
EAAVLFDQTSFAKFTLKGPDALAAMNWICANDVDKPVGSLIYTQMLNDKGGIECDLTVGR
VAQDEFYIVTGTGYVTHDFDWIRRNIPEGMNCQLFDITSSNAVLSLMGPKARDILAAVTR
DDVSNDGFQFGTIRTIGIAGCPVQALRVTYVGELGWELHLPVEYAQTVYAALMGVGQPLG
LVDAGYRAIESLRLEKGYRAWGSDIGPDHTPFEAGLGWAVKLRKKIAFKGRAAAEARKAG
GVKKMLACFTTDPGVVLMGRETIYRNGKRVGWLTSGGYGYTVGQSIGYGYIRNPDGVDPD
YVLSGDYELEVATQRVPCNVQLGPLYDPSMSRVKV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory