Comparing GFF2300 FitnessBrowser__Phaeo:GFF2300 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 87% coverage: 22:252/266 of query aligns to 92:324/346 of Q6NPM8
5eq8A Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol (see paper)
38% identity, 88% coverage: 33:265/266 of query aligns to 22:258/259 of 5eq8A
5eq9B Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol phosphate and mg2+ (see paper)
38% identity, 88% coverage: 33:265/266 of query aligns to 23:259/260 of 5eq9B
5t3jA Histidinol phosphate phosphatase(hpp) soaked with selenourea for 10 min (see paper)
39% identity, 82% coverage: 48:265/266 of query aligns to 30:256/257 of 5t3jA
Sites not aligning to the query:
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
28% identity, 85% coverage: 18:244/266 of query aligns to 4:245/274 of 4as5A
O55023 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Mus musculus (Mouse) (see paper)
28% identity, 85% coverage: 18:244/266 of query aligns to 6:247/277 of O55023
Q19420 Inositol monophosphatase ttx-7; IMP; IMPase; Abnormal thermotaxis protein 7; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase; EC 3.1.3.25; EC 3.1.3.94 from Caenorhabditis elegans (see paper)
31% identity, 78% coverage: 50:256/266 of query aligns to 49:268/285 of Q19420
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
32% identity, 71% coverage: 50:237/266 of query aligns to 40:232/267 of P0ADG4
Sites not aligning to the query:
2p3nA Thermotoga maritima impase tm1415 (see paper)
32% identity, 76% coverage: 50:250/266 of query aligns to 38:234/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
32% identity, 76% coverage: 50:250/266 of query aligns to 38:234/256 of O33832
6tqoT Rrn anti-termination complex (see paper)
32% identity, 71% coverage: 50:237/266 of query aligns to 32:224/255 of 6tqoT
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
32% identity, 71% coverage: 50:237/266 of query aligns to 44:236/270 of 6ib8B
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
28% identity, 88% coverage: 18:251/266 of query aligns to 4:252/274 of 2bjiA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
28% identity, 88% coverage: 18:251/266 of query aligns to 6:254/277 of P20456
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
31% identity, 71% coverage: 50:237/266 of query aligns to 40:232/262 of 2qflA
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
30% identity, 74% coverage: 41:237/266 of query aligns to 28:230/255 of 5yhtA
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 74% coverage: 41:237/266 of query aligns to 31:233/260 of P95189
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
30% identity, 74% coverage: 41:237/266 of query aligns to 29:231/256 of 5zonA
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
31% identity, 83% coverage: 45:266/266 of query aligns to 33:256/259 of 2cziA
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
31% identity, 83% coverage: 45:266/266 of query aligns to 51:279/288 of O14732
>GFF2300 FitnessBrowser__Phaeo:GFF2300
MTMTSSTPERPATEKILQDCVAWAELSASTALSFFRQGTAVDFKADLSPVTLADQTVERE
LKAAIAARYPYHAILGEETGIVGDCKDHLWVIDPIDGTRSFISGHPLFGMLIAFLSHGQL
QAGTISMPALNEVYCGGLGVPATCNGIPIQVSGQRELNSAVLYINEGEKLLENHPAIATR
LLQAGQTRRFGYDCYPHALLAAGHVDAVIDYDLKPYDFLAVSAVIEAAGGLMTDWQGKTL
TLDSDGAVVSAASPELHATLVDLLNS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory