SitesBLAST
Comparing GFF2305 FitnessBrowser__WCS417:GFF2305 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
59% identity, 98% coverage: 6:259/259 of query aligns to 3:256/256 of Q48436
- 6:33 (vs. 9:36, 71% identical) binding
- D59 (= D62) binding
- K156 (= K159) binding
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
59% identity, 98% coverage: 6:259/259 of query aligns to 3:256/256 of 1gegE
- active site: G13 (= G16), S139 (= S142), Y152 (= Y155), K156 (= K159), V197 (≠ M200)
- binding alpha-D-glucopyranose: R63 (= R66), D64 (≠ E67), F67 (≠ V70), E123 (≠ K126)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), Q12 (= Q15), I14 (= I17), D33 (= D36), Y34 (≠ I37), V58 (≠ A61), D59 (= D62), V60 (= V63), N86 (= N89), A87 (= A90), I109 (= I112), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), V185 (= V188), T187 (= T190), M189 (= M192)
3wyeA Crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with NAD+
60% identity, 98% coverage: 6:259/259 of query aligns to 2:255/255 of 3wyeA
- active site: G12 (= G16), S138 (= S142), Y151 (= Y155), K155 (= K159), L196 (≠ M200)
- binding nicotinamide-adenine-dinucleotide: G8 (= G12), Q11 (= Q15), G12 (= G16), I13 (= I17), D32 (= D36), Y33 (≠ I37), V57 (≠ A61), D58 (= D62), V59 (= V63), N85 (= N89), A86 (= A90), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), V184 (= V188), T186 (= T190), M188 (= M192), W189 (= W193)
Q9ZNN8 L-2,3-butanediol dehydrogenase; L-BDH; (S,S)-butanediol dehydrogenase; Diacetyl reductase [(S)-acetoin forming]; EC 1.1.1.76; EC 1.1.1.304 from Corynebacterium glutamicum (Brevibacterium saccharolyticum) (see paper)
53% identity, 98% coverage: 6:259/259 of query aligns to 3:258/258 of Q9ZNN8
- QGI 12:14 (= QGI 15:17) binding
- D33 (= D36) binding
- Q37 (≠ L42) binding
- DV 61:62 (= DV 62:63) binding
- N88 (= N89) binding
- I142 (= I143) mutation to Q: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with N-148.; mutation to Q: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- F148 (= F149) mutation to N: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with Q-142.; mutation to N: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- Y154 (= Y155) binding
- K158 (= K159) binding
- PGIVGT 184:189 (≠ PGVVGT 185:190) binding
3a28C Crystal structure of l-2,3-butanediol dehydrogenase (see paper)
53% identity, 98% coverage: 6:259/259 of query aligns to 2:257/257 of 3a28C
- active site: G12 (= G16), S140 (= S142), Y153 (= Y155), K157 (= K159), L198 (≠ M200)
- binding nicotinamide-adenine-dinucleotide: G8 (= G12), Q11 (= Q15), I13 (= I17), D32 (= D36), L33 (≠ I37), Q36 (≠ L42), L59 (vs. gap), D60 (= D62), V61 (= V63), N87 (= N89), S140 (= S142), Y153 (= Y155), K157 (= K159), P183 (= P185), V186 (= V188), T188 (= T190), M190 (= M192), W191 (= W193)
6pejA Structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol
38% identity, 98% coverage: 3:255/259 of query aligns to 4:253/257 of 6pejA
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
39% identity, 98% coverage: 3:256/259 of query aligns to 5:255/258 of 3ak4A
- active site: G18 (= G16), S141 (= S142), L151 (= L152), Y154 (= Y155), K158 (= K159), E199 (≠ M200)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ Q15), G18 (= G16), I19 (= I17), D38 (= D36), L39 (= L42), V60 (vs. gap), D61 (= D62), V62 (= V63), N88 (= N89), A89 (= A90), G90 (= G91), T139 (≠ A140), S141 (= S142), Y154 (= Y155), K158 (= K159), G185 (= G186), V187 (= V188), T189 (= T190), M191 (= M192)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
38% identity, 97% coverage: 7:256/259 of query aligns to 3:242/244 of 1edoA
- active site: G12 (= G16), S138 (= S142), Y151 (= Y155), K155 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (≠ G14), R11 (≠ Q15), I13 (= I17), N31 (= N38), Y32 (≠ G39), A33 (= A40), R34 (= R41), S35 (vs. gap), D59 (= D62), V60 (= V63), N86 (= N89), A87 (= A90), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), I184 (≠ V188), S186 (≠ T190), M188 (= M192)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
38% identity, 98% coverage: 3:256/259 of query aligns to 3:245/247 of 6j7uA
- active site: G16 (= G16), S142 (= S142), Y156 (= Y155)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (≠ Q15), I17 (= I17), Y36 (≠ D36), V37 (≠ I37), S38 (≠ N38), S41 (≠ R41), D65 (= D62), S66 (≠ V63), N92 (= N89), A93 (= A90), G94 (= G91), I115 (= I112), G141 (≠ C141), S142 (= S142), Y156 (= Y155), K160 (= K159), P186 (= P185), T191 (= T190), M193 (= M192), N194 (≠ W193)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 99% coverage: 1:257/259 of query aligns to 1:246/247 of 4jroC
- active site: G16 (= G16), S142 (= S142), Q152 (≠ L152), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (≠ Q15), G16 (= G16), I17 (= I17), N35 (≠ D36), Y36 (≠ I37), N37 (= N38), G38 (= G39), S39 (≠ A40), N63 (≠ D62), V64 (= V63), N90 (= N89), A91 (= A90), I93 (≠ V92), I113 (= I112), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (≠ V188), T190 (= T190)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
36% identity, 97% coverage: 6:256/259 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G16), S138 (= S142), Q148 (≠ L152), Y151 (= Y155), K155 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (≠ G14), R11 (≠ Q15), I13 (= I17), N31 (≠ D36), Y32 (≠ I37), A33 (≠ N38), G34 (= G39), S35 (≠ A40), A58 (= A61), N59 (≠ D62), V60 (= V63), N86 (= N89), A87 (= A90), T109 (≠ I112), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
36% identity, 97% coverage: 6:256/259 of query aligns to 5:244/246 of 3osuA
1zemA Crystal structure of NAD+-bound xylitol dehydrogenase (see paper)
35% identity, 98% coverage: 3:255/259 of query aligns to 3:260/260 of 1zemA
- active site: N16 (≠ G16), S142 (= S142), Y155 (= Y155), K159 (= K159), D212 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), G15 (≠ Q15), N16 (≠ G16), I17 (= I17), D36 (= D36), M37 (≠ I37), D62 (= D62), V63 (= V63), N89 (= N89), A90 (= A90), G91 (= G91), T140 (≠ A140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), M188 (≠ V188)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 97% coverage: 6:257/259 of query aligns to 8:243/244 of 4nbuB
- active site: G18 (= G16), N111 (= N113), S139 (= S142), Q149 (≠ L152), Y152 (= Y155), K156 (= K159)
- binding acetoacetyl-coenzyme a: D93 (≠ I95), K98 (≠ E100), S139 (= S142), N146 (≠ F149), V147 (≠ A150), Q149 (≠ L152), Y152 (= Y155), F184 (≠ V187), M189 (= M192), K200 (≠ I203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ Q15), G18 (= G16), I19 (= I17), D38 (= D36), F39 (≠ I37), V59 (≠ A61), D60 (= D62), V61 (= V63), N87 (= N89), A88 (= A90), G89 (= G91), I90 (≠ V92), T137 (≠ A140), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), F184 (≠ V187), T185 (≠ V188), T187 (= T190), M189 (= M192)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
37% identity, 98% coverage: 3:257/259 of query aligns to 4:238/244 of 1nfqA
- active site: G17 (= G16), S139 (= S142), Y152 (= Y155), K156 (= K159)
- binding Androsterone: L91 (≠ A93), E141 (≠ A144), C149 (≠ L152), Y152 (= Y155), V193 (= V194), I197 (≠ V216), F198 (≠ D217)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ Q15), G17 (= G16), M18 (≠ I17), D37 (= D36), L39 (≠ N38), L59 (≠ V58), D60 (= D62), V61 (= V63), N87 (= N89), A88 (= A90), I137 (≠ A140), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), V185 (= V188), T187 (= T190), P188 (≠ D191), M189 (= M192), T190 (vs. gap)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
37% identity, 98% coverage: 3:257/259 of query aligns to 4:238/244 of 1nffA
- active site: G17 (= G16), S139 (= S142), Y152 (= Y155), K156 (= K159)
- binding nicotinamide-adenine-dinucleotide: G13 (= G12), R16 (≠ Q15), G17 (= G16), M18 (≠ I17), D37 (= D36), I38 (= I37), L39 (≠ N38), L59 (≠ V58), D60 (= D62), V61 (= V63), N87 (= N89), A88 (= A90), G89 (= G91), I90 (≠ V92), I137 (≠ A140), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), V185 (= V188), T187 (= T190), P188 (≠ D191), M189 (= M192), T190 (vs. gap)
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
35% identity, 97% coverage: 7:256/259 of query aligns to 10:249/251 of 4cqlI
- active site: G19 (= G16), S146 (= S142), Y159 (= Y155), K163 (= K159)
- binding nicotinamide-adenine-dinucleotide: S18 (≠ Q15), G19 (= G16), I20 (= I17), D39 (= D36), L40 (≠ I37), A64 (= A61), D65 (= D62), V66 (= V63), C93 (≠ N89), A94 (= A90), G95 (= G91), I96 (≠ V92), V116 (≠ I112), I144 (≠ A140), S146 (= S142), Y159 (= Y155), K163 (= K159), P189 (= P185), G190 (= G186), I192 (≠ V188), T194 (= T190), M196 (= M192)
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 98% coverage: 3:257/259 of query aligns to 5:239/260 of P9WGT1
- I6 (≠ T4) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ QGI 15:17) binding
- D38 (= D36) binding
- V47 (= V45) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (= DV 62:63) binding
- T69 (≠ V70) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (= N89) binding
- S140 (= S142) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y155) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K159) binding
- 183:191 (vs. 185:192, 56% identical) binding
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
34% identity, 99% coverage: 3:259/259 of query aligns to 8:247/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), D19 (≠ G14), L22 (≠ I17), I42 (≠ G39), D65 (= D62), M66 (≠ V63), N92 (= N89), A93 (= A90), G94 (= G91), L115 (≠ I112), I143 (≠ A140), S145 (= S142), Y158 (= Y155), K162 (= K159), G189 (= G186), M191 (≠ V188), T193 (= T190), N195 (≠ E195)
4cqmA Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
34% identity, 97% coverage: 7:256/259 of query aligns to 8:246/248 of 4cqmA
- active site: G17 (= G16), S143 (= S142), Y156 (= Y155), K160 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), S16 (≠ Q15), G17 (= G16), I18 (= I17), D37 (= D36), L38 (≠ I37), A61 (= A61), V63 (= V63), C90 (≠ N89), A91 (= A90), G92 (= G91), I93 (≠ V92), V113 (≠ I112), I141 (≠ A140), S143 (= S142), Y156 (= Y155), K160 (= K159), P186 (= P185), G187 (= G186), I189 (≠ V188), T191 (= T190), P192 (≠ D191), M193 (= M192), T194 (≠ W193)
Query Sequence
>GFF2305 FitnessBrowser__WCS417:GFF2305
MAITGKVALVTGAGQGIGRAIALRLAQDGADIALVDINGARLEAVASEVVALGRQASVFV
ADVSKREQVVAAVEHAHQTLGGFDIIVNNAGVAQIDSLLEVSPEQVERTLGINVQGVLWG
IQAAGKKFKALKQKGKIINACSIAGHEGFALLGVYSATKFAVRALTQAAAKELASAGITV
NAYCPGVVGTDMWVEIDKRMAEITGADVGATYKKYVDGIALGRAETPEDVAGLVSYLAGP
DSDYMTGQSPLIDGGLVYR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory