SitesBLAST
Comparing GFF2307 FitnessBrowser__Phaeo:GFF2307 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
34% identity, 100% coverage: 3:806/807 of query aligns to 24:823/824 of Q8GAI3
- W66 (= W46) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (= H47) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
34% identity, 99% coverage: 6:806/807 of query aligns to 50:858/866 of Q9UI17
- CV 59:60 (≠ II 15:16) binding
- EK 80:81 (= EK 36:37) binding
- 87:95 (vs. 43:51, 89% identical) binding
- H91 (= H47) modified: Tele-8alpha-FAD histidine
- H109 (≠ L65) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V175) binding
- S279 (≠ P235) to P: in dbSNP:rs532964
- FGYGII 397:402 (≠ FLYGIA 348:353) binding
- A530 (≠ V482) to G: in dbSNP:rs1805073
- S646 (≠ E598) to P: in dbSNP:rs1805074
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
34% identity, 99% coverage: 6:806/807 of query aligns to 6:814/824 of 4pabB
- active site: T53 (≠ G53), E102 (= E102), H226 (= H226), Y255 (= Y254), E536 (≠ D533)
- binding flavin-adenine dinucleotide: I11 (= I11), G12 (= G12), G14 (= G14), C15 (≠ I15), V16 (≠ I16), L35 (= L35), E36 (= E36), K37 (= K37), G43 (= G43), S44 (≠ A44), T45 (= T45), H47 (= H47), A48 (= A48), A49 (= A49), G50 (= G50), L51 (= L51), V175 (= V175), A204 (≠ T204), G205 (= G205), W207 (= W207), H226 (= H226), Y228 (= Y228), G326 (= G321), I328 (= I323), F353 (= F348), Y355 (= Y350), G356 (= G351), I357 (= I352), I358 (≠ A353)
- binding (6s)-5,6,7,8-tetrahydrofolate: I523 (≠ L523), E536 (≠ D533), T538 (= T535), I550 (≠ V547), F612 (= F608), L613 (≠ A609), Y632 (= Y628), E639 (= E635), F680 (≠ Y676), Y700 (≠ G696)
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
34% identity, 99% coverage: 6:806/807 of query aligns to 43:851/857 of Q63342
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
32% identity, 100% coverage: 2:806/807 of query aligns to 1:829/830 of Q9AGP8
- IV 14:15 (≠ II 15:16) binding
- DQ 35:36 (≠ EK 36:37) binding
- STSH 45:48 (≠ ATWH 44:47) binding
- L52 (= L51) binding
- V174 (= V175) binding
- H225 (= H226) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (= Y254) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- VW--VT 360:363 (≠ FLYGIA 348:353) binding
- Y539 (= Y520) binding
- D552 (= D533) Important for catalytic activity; mutation to A: No effect on the activity.; mutation to N: Reduces activity 3-fold.
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
32% identity, 99% coverage: 9:806/807 of query aligns to 6:827/828 of 1pj6A
- active site: H223 (= H226), Y257 (= Y254), D550 (= D533)
- binding flavin-adenine dinucleotide: G9 (= G12), G11 (= G14), I12 (= I15), V13 (≠ I16), D33 (≠ E36), Q34 (≠ K37), G42 (= G43), S43 (≠ A44), T44 (= T45), H46 (= H47), P48 (≠ A49), L50 (= L51), V172 (= V175), A201 (≠ T204), G202 (= G205), W204 (= W207), H223 (= H226), Y257 (= Y254), G331 (= G321), I332 (≠ P322), V358 (≠ F348), W359 (≠ L349), V360 (≠ I352), T361 (≠ A353)
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
32% identity, 99% coverage: 9:806/807 of query aligns to 5:826/827 of 1pj7A
- active site: H222 (= H226), Y256 (= Y254), D549 (= D533)
- binding flavin-adenine dinucleotide: G8 (= G12), G10 (= G14), I11 (= I15), V12 (≠ I16), D32 (≠ E36), Q33 (≠ K37), G41 (= G43), S42 (≠ A44), T43 (= T45), H45 (= H47), P47 (≠ A49), L49 (= L51), T170 (≠ K174), V171 (= V175), A200 (≠ T204), G201 (= G205), W203 (= W207), H222 (= H226), Y256 (= Y254), I331 (≠ P322), V357 (≠ F348), W358 (≠ L349), V359 (≠ I352), T360 (≠ A353)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: L505 (≠ F489), Y536 (= Y520), D549 (= D533), T551 (= T535), G563 (= G549), F629 (≠ A609), Y648 (= Y628), E655 (= E635), Y696 (= Y676)
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
32% identity, 99% coverage: 9:806/807 of query aligns to 5:826/827 of 3gsiA
- active site: H222 (= H226), Y256 (= Y254), A549 (≠ D533)
- binding flavin-adenine dinucleotide: G10 (= G14), I11 (= I15), V12 (≠ I16), D32 (≠ E36), Q33 (≠ K37), G41 (= G43), S42 (≠ A44), T43 (= T45), H45 (= H47), P47 (≠ A49), L49 (= L51), T170 (≠ K174), V171 (= V175), A200 (≠ T204), G201 (= G205), W203 (= W207), H222 (= H226), Y256 (= Y254), G330 (= G321), I331 (≠ P322), F332 (≠ I323), V357 (≠ F348), W358 (≠ L349), V359 (≠ I352), T360 (≠ A353)
- binding magnesium ion: D254 (≠ L252), V409 (≠ A402)
- binding (6s)-5,6,7,8-tetrahydrofolate: L505 (≠ F489), Y536 (= Y520), T551 (= T535), G563 (= G549), F629 (≠ A609), Y648 (= Y628), E655 (= E635), Y696 (= Y676)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 43% coverage: 420:764/807 of query aligns to 1:321/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 43% coverage: 420:764/807 of query aligns to 1:321/362 of 1wopA
- active site: D96 (= D533)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: M51 (≠ F489), L55 (≠ E493), Y83 (= Y520), D96 (= D533), V98 (≠ T535), E106 (≠ H543), L108 (≠ Y545), V110 (= V547), N112 (≠ G549), I137 (≠ M575), E160 (= E598), Y168 (≠ F606), Y169 (≠ F608), K173 (≠ Q612), S174 (≠ D613), I175 (= I614), E180 (≠ A619), T181 (= T620), Y188 (= Y628), E195 (= E635), M197 (≠ H637), R227 (≠ I667), Y236 (= Y676)
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 43% coverage: 420:764/807 of query aligns to 1:321/362 of 1wooA
- active site: D96 (= D533)
- binding (6s)-5,6,7,8-tetrahydrofolate: M51 (≠ F489), Y83 (= Y520), D96 (= D533), V98 (≠ T535), V110 (= V547), N112 (≠ G549), Y168 (≠ F606), Y169 (≠ F608), Y188 (= Y628), E195 (= E635), Y236 (= Y676)
Sites not aligning to the query:
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
29% identity, 39% coverage: 421:738/807 of query aligns to 575:887/965 of Q50LF0
Sites not aligning to the query:
- 139 binding
- 158 binding
- 159 binding
- 160 binding
- 166 binding
- 205 binding
- 418 binding
- 423 binding
- 425 binding
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
29% identity, 39% coverage: 421:738/807 of query aligns to 574:886/963 of 3ad7A
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
29% identity, 39% coverage: 421:738/807 of query aligns to 574:886/963 of 1vrqA
- active site: D676 (= D533)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: L631 (≠ F489), Y663 (= Y520), G677 (≠ I534), H690 (≠ V547), I774 (= I626), F776 (≠ Y628), E783 (= E635), K822 (= K674), F824 (≠ Y676)
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
29% identity, 40% coverage: 421:745/807 of query aligns to 577:896/967 of Q46337
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 139 G→A: Does not affect activity and binding of NAD(+).
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
28% identity, 41% coverage: 421:754/807 of query aligns to 575:900/965 of 2gagA
Sites not aligning to the query:
- active site: 350, 375
- binding flavin mononucleotide: 510, 511, 517, 521, 549, 551
- binding nicotinamide-adenine-dinucleotide: 134, 135, 137, 138, 139, 158, 159, 160, 165, 166, 204, 205, 249, 250, 295, 381, 417, 418, 423, 424, 425, 554
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
26% identity, 45% coverage: 21:383/807 of query aligns to 20:368/374 of 1y56B
- active site: F44 (≠ W46), G47 (≠ A49), T48 (≠ G50), H224 (= H226), P239 (≠ K241), G305 (= G321), M338 (≠ A353)
- binding flavin-adenine dinucleotide: I33 (≠ L35), E34 (= E36), K35 (= K37), S42 (≠ A44), T43 (= T45), R45 (≠ H47), C46 (≠ A48), G47 (≠ A49), G49 (≠ L51), E170 (≠ K174), V171 (= V175), T200 (= T204), N201 (≠ G205), W203 (= W207), G305 (= G321), Y306 (≠ P322), Y307 (≠ I323), G334 (vs. gap), H335 (≠ Y350), G336 (= G351), F337 (≠ I352), M338 (≠ A353)
- binding flavin mononucleotide: F44 (≠ W46), R45 (≠ H47), I260 (= I265), R301 (≠ Q317), W303 (≠ I319)
Sites not aligning to the query:
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
26% identity, 47% coverage: 420:802/807 of query aligns to 33:398/403 of P48728
- D129 (= D533) mutation D->A,N: Loss of aminomethyltransferase activity.
- N145 (≠ G549) to I: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs386833682
- E232 (= E635) binding
- R261 (≠ I667) binding
- G269 (= G675) to D: in GCE2; decreased aminomethyltransferase activity; dbSNP:rs121964981
- R320 (≠ C725) to H: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs121964985
Sites not aligning to the query:
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
26% identity, 47% coverage: 420:802/807 of query aligns to 2:367/371 of 1wsvA
- active site: D98 (= D533)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: M53 (≠ F489), L85 (≠ I519), D98 (= D533), L99 (≠ I534), I100 (≠ T535), V112 (= V547), N114 (≠ G549), F173 (= F608), G193 (= G627), Y194 (= Y628), E201 (= E635), R230 (≠ I667), L239 (≠ Y676)
Sites not aligning to the query:
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
28% identity, 45% coverage: 10:370/807 of query aligns to 6:347/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I11), G8 (= G12), G10 (= G14), V11 (≠ I15), I12 (= I16), V30 (≠ L35), E31 (= E36), K32 (= K37), E38 (≠ G43), A39 (= A44), S40 (≠ T45), A43 (= A48), G45 (= G50), L46 (= L51), V171 (= V175), G200 (≠ T204), G201 (= G205), W203 (= W207), G298 (= G321), R300 (≠ I323), P301 (= P324), Y326 (≠ F348), R327 (≠ L349), N328 (≠ Y350), G329 (= G351), I330 (= I352)
Query Sequence
>GFF2307 FitnessBrowser__Phaeo:GFF2307
MITHSAKHLIIGGGIIGCSIAYHLARAGEKDVVLLEKASLTEGATWHAAGLVGQLRSSRN
TTRMLKRSVALYDRLADETGMEFDWKKVGSLRLAATRERLLEAKRLATMARSFDLEMEII
TAAEAKELFPYIDAKDLEGAAFIPSDGHVDPASLCQAIAAGARMHGAKICQGVKVEDFEV
HGGRITKVMTSHGDYEAETVVLATGMWSRELAAKLGVVVPACAVEHQYIVTEPLPQPELV
KGLPTLRDPERLVYYKPDAGGRLVIGGYEEGTLPFGDRGIPGEFVRQLLPDNLDRFAPLA
ELAGQVTPVVNEVGIRQVINGPIPYSADGDFVMGWAPELRNLMLSTGFLYGIAAGGGAGE
MIAEWILEGRPSLDLWPLDVRRFSPHHATRAFMYPRAVEHYAHHYKMRYPGQEAETARNL
RLSPLHDRLKQHGAVFGSKNGWERPLWFAPEGVEPVDQLDFLNPGWKVFAEQEHSAVRNG
VVLIDQSSFSKFELIGPGALAAIQNLAVSNMDKPDGAVIYTQLCNMQGGTEADITVTRLG
RDHFYIVTGAGFGVHDADWIRRHLPEDGSAQLIEMTSARAVINLCGPKSREVLQAVSEED
VSNRAFPFATAQDITLGAATVRAARIGYTGELGWELHVPTEFALHVYDLLWQAGQEHGIR
DIGYRAIESLRLEKGYVYWSADITPDYSPVEAGLAGRVHLKSKEDFLGRAILDRQKREGT
SQQLCTFTVDERLPMTGGETILHKGKAVSLASSGGYGPTAEKTIVYGYLPTALVGERDFE
LELFGRRQALRQVDGPLYDPTNDRLKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory