SitesBLAST
Comparing GFF231 FitnessBrowser__psRCH2:GFF231 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
59% identity, 97% coverage: 4:365/372 of query aligns to 3:365/366 of 3dmeA
- binding flavin-adenine dinucleotide: I8 (≠ V9), G9 (= G10), G11 (= G12), V12 (= V13), V13 (= V14), E32 (= E33), A33 (= A34), T41 (= T42), S42 (= S43), R44 (= R45), N45 (= N46), S46 (= S47), V48 (= V49), H50 (= H51), P170 (= P171), L171 (vs. gap), A203 (= A203), I313 (= I313), R314 (= R314), I346 (= I346), E347 (= E347), S348 (= S348), P349 (= P349), G350 (= G350), L351 (= L351), T352 (= T352)
8w7fB Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion (see paper)
31% identity, 92% coverage: 28:368/372 of query aligns to 29:408/412 of 8w7fB
- binding flavin-adenine dinucleotide: E34 (= E33), K35 (≠ A34), H42 (≠ A41), Q43 (≠ T42), S44 (= S43), H46 (≠ R45), N47 (= N46), S48 (= S47), V50 (= V49), H52 (= H51), V173 (= V172), G205 (≠ A203), G206 (= G204), Q208 (≠ G206), Y231 (= Y232), V350 (≠ I313), R351 (= R314), P389 (= P349), G390 (= G350), A391 (≠ L351), T392 (= T352)
Sites not aligning to the query:
8w78A Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate (see paper)
31% identity, 92% coverage: 28:368/372 of query aligns to 29:406/410 of 8w78A
- binding 2-oxoglutaric acid: S48 (= S47), H52 (= H51), Y245 (= Y246), F254 (≠ G253), L255 (= L254), H258 (= H257), R349 (= R314)
- binding flavin-adenine dinucleotide: E34 (= E33), K35 (≠ A34), H42 (≠ A41), Q43 (≠ T42), S44 (= S43), N47 (= N46), S48 (= S47), V50 (= V49), H52 (= H51), V173 (= V172), G203 (≠ A203), G204 (= G204), Q206 (≠ G206), R349 (= R314), P387 (= P349), G388 (= G350), A389 (≠ L351), T390 (= T352)
Sites not aligning to the query:
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
29% identity, 99% coverage: 1:368/372 of query aligns to 1:368/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G10), G12 (= G12), I14 (≠ V14), E33 (= E33), K34 (≠ A34), E41 (≠ A41), T42 (= T42), S43 (= S43), A45 (≠ R45), N46 (= N46), S47 (= S47), V49 (= V49), H51 (= H51), E176 (≠ P171), V177 (= V172), A209 (= A203), G210 (= G204), Y212 (≠ G206), Y234 (= Y232), S319 (≠ I313), R320 (= R314), M346 (≠ I346), K347 (≠ E347), S348 (= S348), P349 (= P349), G350 (= G350), L351 (= L351), T352 (= T352)
- binding sn-glycerol-3-phosphate: S47 (= S47), H51 (= H51), K258 (≠ L254), G259 (= G255), R320 (= R314), S348 (= S348)
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
29% identity, 99% coverage: 1:368/372 of query aligns to 1:368/384 of P75063
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
29% identity, 55% coverage: 2:207/372 of query aligns to 41:245/857 of Q63342
- CV 52:53 (≠ VV 13:14) binding
- EK 73:74 (≠ EA 33:34) binding
- 80:88 (vs. 38:46, 22% identical) binding
- H84 (≠ T42) modified: Tele-8alpha-FAD histidine
- V212 (= V172) binding
- W244 (≠ G206) binding
Sites not aligning to the query:
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
29% identity, 55% coverage: 2:207/372 of query aligns to 4:208/824 of 4pabB
- active site: T53 (≠ E48), E102 (≠ A101)
- binding flavin-adenine dinucleotide: I11 (≠ V9), G12 (= G10), G14 (= G12), C15 (≠ V13), V16 (= V14), L35 (= L32), E36 (= E33), K37 (≠ A34), G43 (≠ F38), S44 (≠ G39), T45 (= T40), H47 (≠ T42), A48 (≠ S43), A49 (= A44), G50 (≠ R45), L51 (≠ N46), V175 (= V172), A204 (= A203), G205 (= G204), W207 (≠ G206)
Sites not aligning to the query:
- active site: 226, 255, 536
- binding flavin-adenine dinucleotide: 226, 228, 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
29% identity, 55% coverage: 2:207/372 of query aligns to 48:252/866 of Q9UI17
- CV 59:60 (≠ VV 13:14) binding
- EK 80:81 (≠ EA 33:34) binding
- 87:95 (vs. 38:46, 22% identical) binding
- H91 (≠ T42) modified: Tele-8alpha-FAD histidine
- H109 (≠ V67) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V172) binding
Sites not aligning to the query:
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
Query Sequence
>GFF231 FitnessBrowser__psRCH2:GFF231
MDRVDCVVVGAGVVGLAVACALALAGREVLVLEAEAAFGTATSARNSEVIHAGIYYPQGS
LKGRLCVAGRRQLYDFCDSHGVAYRRCGKLIVATDEAQIAALEQLQRHAQANGVDDLQRL
DGHEVLALEPQLHAVAGLLSPSTGIIDSHALMLALLGDAERHGAVLALNAPVADIVAASD
GLRVEVGGADPLQLLARTVVNCAGHGAPVLAARTQGLSDAARPRQFFAKGSYFSLSGCTP
FRHLVYPLPEPGGLGVHLTLDLAGQARFGPDVQWVDDLDYRIEPARAEGFYAAIRRYWPG
LPDDALQPAYTGIRPKISGPGEAAADFRIDGPAQHGIAGLVNLFGIESPGLTACLAIAEH
VCGLLEHKALAT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory