SitesBLAST
Comparing GFF2310 FitnessBrowser__psRCH2:GFF2310 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
44% identity, 96% coverage: 9:250/252 of query aligns to 5:246/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
44% identity, 96% coverage: 9:250/252 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G19), S138 (= S144), Q148 (≠ Y154), Y151 (= Y157), K155 (= K161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G15), S10 (≠ A17), R11 (≠ T18), I13 (= I20), N31 (= N38), Y32 (≠ H39), A33 (≠ R40), G34 (≠ D41), S35 (≠ Q42), A58 (= A65), N59 (≠ D66), V60 (= V67), N86 (= N92), A87 (= A93), T109 (≠ V115), S138 (= S144), Y151 (= Y157), K155 (= K161), P181 (= P187), G182 (= G188)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
40% identity, 97% coverage: 6:250/252 of query aligns to 3:243/244 of 6t77A
- active site: G16 (= G19), S138 (= S144), Y151 (= Y157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (≠ A17), R15 (≠ T18), T37 (≠ D41), L58 (≠ A65), N59 (≠ D66), V60 (= V67), A87 (= A93), G88 (= G94), I89 (≠ V95)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 97% coverage: 6:250/252 of query aligns to 3:243/244 of P0A2C9
- M125 (= M131) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ L230) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S231) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
42% identity, 96% coverage: 9:250/252 of query aligns to 7:246/247 of P73574
- A14 (= A16) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ E152) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K161) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ P189) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ S201) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
40% identity, 94% coverage: 12:247/252 of query aligns to 5:241/244 of 1edoA
- active site: G12 (= G19), S138 (= S144), Y151 (= Y157), K155 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G15), S10 (≠ A17), R11 (≠ T18), I13 (= I20), N31 (= N38), Y32 (≠ H39), A33 (≠ R40), R34 (≠ D41), S35 (≠ Q42), D59 (= D66), V60 (= V67), N86 (= N92), A87 (= A93), S138 (= S144), Y151 (= Y157), K155 (= K161), P181 (= P187), G182 (= G188), I184 (= I190), S186 (≠ T192), M188 (= M194)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
40% identity, 97% coverage: 6:250/252 of query aligns to 3:243/244 of P0AEK2
- GASR 12:15 (≠ GAAT 15:18) binding
- T37 (≠ D41) binding
- NV 59:60 (≠ DV 66:67) binding
- N86 (= N92) binding
- Y151 (= Y157) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YCTAK 157:161) binding
- A154 (= A160) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K161) mutation to A: Defect in the affinity for NADPH.
- I184 (= I190) binding
- E233 (≠ Q240) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
40% identity, 97% coverage: 6:250/252 of query aligns to 2:242/243 of 1q7bA
- active site: G15 (= G19), E101 (≠ D108), S137 (= S144), Q147 (≠ Y154), Y150 (= Y157), K154 (= K161)
- binding calcium ion: E232 (≠ Q240), T233 (≠ L241)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G15), S13 (≠ A17), R14 (≠ T18), T36 (≠ D41), N58 (≠ D66), V59 (= V67), N85 (= N92), A86 (= A93), G87 (= G94), I88 (≠ V95), S137 (= S144), Y150 (= Y157), K154 (= K161), P180 (= P187), G181 (= G188), I183 (= I190)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 96% coverage: 8:250/252 of query aligns to 5:247/247 of 4jroC
- active site: G16 (= G19), S142 (= S144), Q152 (≠ Y154), Y155 (= Y157), K159 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (≠ A17), R15 (≠ T18), G16 (= G19), I17 (= I20), N35 (= N38), Y36 (≠ H39), N37 (≠ R40), G38 (≠ D41), S39 (≠ Q42), N63 (≠ D66), V64 (= V67), N90 (= N92), A91 (= A93), I93 (≠ V95), I113 (≠ V115), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), I188 (= I190), T190 (= T192)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
38% identity, 96% coverage: 8:250/252 of query aligns to 8:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G15), S17 (≠ A17), R18 (≠ T18), I20 (= I20), T40 (≠ R40), N62 (≠ D66), V63 (= V67), N89 (= N92), A90 (= A93), I92 (≠ V95), V139 (= V142), S141 (= S144), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (= G188), I187 (= I190), T189 (= T192), M191 (= M194)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
45% identity, 96% coverage: 9:250/252 of query aligns to 6:239/240 of 4dmmB
- active site: G16 (= G19), S142 (= S144), Q152 (≠ Y154), Y155 (= Y157), K159 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (≠ A17), R15 (≠ T18), G16 (= G19), I17 (= I20), A37 (≠ R40), S38 (≠ D41), S39 (≠ Q42), A62 (= A65), D63 (= D66), V64 (= V67), N90 (= N92), A91 (= A93), L113 (≠ V115), I140 (≠ V142), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), G186 (= G188), I188 (= I190), T190 (= T192), M192 (= M194)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
38% identity, 96% coverage: 8:250/252 of query aligns to 8:242/243 of 4i08A
- active site: G19 (= G19), N113 (≠ D116), S141 (= S144), Q151 (≠ Y154), Y154 (= Y157), K158 (= K161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G15), S17 (≠ A17), R18 (≠ T18), I20 (= I20), T40 (≠ R40), N62 (≠ D66), V63 (= V67), N89 (= N92), A90 (= A93), G140 (≠ A143), S141 (= S144), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (= G188), T189 (= T192)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
39% identity, 97% coverage: 6:250/252 of query aligns to 2:242/243 of 1q7cA
- active site: G15 (= G19), S137 (= S144), Q147 (≠ Y154), F150 (≠ Y157), K154 (= K161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G15), S13 (≠ A17), R14 (≠ T18), A35 (≠ R40), T36 (≠ D41), L57 (≠ A65), N58 (≠ D66), V59 (= V67), G87 (= G94), I88 (≠ V95)
4iinA Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 complexed with NAD+
38% identity, 98% coverage: 5:250/252 of query aligns to 3:236/236 of 4iinA
- active site: G17 (= G19), S143 (= S144), Y156 (= Y157), K160 (= K161)
- binding nicotinamide-adenine-dinucleotide: G13 (= G15), G17 (= G19), I18 (= I20), N36 (= N38), R38 (= R40), A65 (≠ V67), N91 (= N92), A92 (= A93), G93 (= G94), V141 (= V142), S143 (= S144), Y156 (= Y157), K160 (= K161), P186 (= P187)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
39% identity, 95% coverage: 9:247/252 of query aligns to 6:244/248 of 6ixmC
- active site: G16 (= G19), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), S15 (≠ T18), G16 (= G19), I17 (= I20), D36 (≠ H39), I37 (≠ R40), A61 (= A65), D62 (= D66), T63 (≠ V67), N89 (= N92), A90 (= A93), M140 (≠ V142), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (≠ G188), Y187 (≠ P189), I188 (= I190), L192 (≠ M194)
8jfgA Crystal structure of 3-oxoacyl-acp reductase fabg in complex with NADP+ and 3-keto-octanoyl-acp from helicobacter pylori (see paper)
39% identity, 98% coverage: 3:250/252 of query aligns to 1:248/248 of 8jfgA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G15), K16 (≠ T18), I18 (= I20), R38 (= R40), A65 (≠ V67), N91 (= N92), A92 (= A93), G93 (= G94), A142 (= A143), S143 (= S144), Y156 (= Y157), K160 (= K161), P186 (= P187), I189 (= I190), T191 (= T192), M193 (= M194), N194 (≠ P197)
- binding ~{S}-[2-[3-[[(2~{S})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] 3-oxidanylideneoctanethioate: D97 (≠ E98), S143 (= S144), I145 (≠ L146), M151 (≠ E152), G152 (≠ Q153), Q153 (≠ Y154), Y156 (= Y157), G187 (= G188), F188 (≠ P189), Y205 (≠ E208)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
38% identity, 97% coverage: 4:247/252 of query aligns to 1:236/239 of 4nbtA
- active site: G16 (= G19), S132 (= S144), Y145 (= Y157), K149 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), K15 (≠ T18), G16 (= G19), L17 (≠ I20), D36 (≠ H39), L37 (≠ R40), L52 (≠ A55), N53 (= N56), V54 (= V67), N80 (= N92), A81 (= A93), G82 (= G94), I130 (≠ V142), S132 (= S144), Y145 (= Y157), K149 (= K161), P177 (= P187), G178 (= G188), I180 (= I190), T182 (= T192)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
39% identity, 98% coverage: 5:250/252 of query aligns to 4:244/244 of 4nbuB
- active site: G18 (= G19), N111 (≠ D116), S139 (= S144), Q149 (≠ Y154), Y152 (= Y157), K156 (= K161)
- binding acetoacetyl-coenzyme a: D93 (≠ E98), K98 (≠ E103), S139 (= S144), N146 (≠ R151), V147 (≠ E152), Q149 (≠ Y154), Y152 (= Y157), F184 (≠ P189), M189 (= M194), K200 (≠ E203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G15), N17 (≠ T18), G18 (= G19), I19 (= I20), D38 (= D41), F39 (≠ Q42), V59 (≠ A65), D60 (= D66), V61 (= V67), N87 (= N92), A88 (= A93), G89 (= G94), I90 (≠ V95), T137 (≠ V142), S139 (= S144), Y152 (= Y157), K156 (= K161), P182 (= P187), F184 (≠ P189), T185 (≠ I190), T187 (= T192), M189 (= M194)
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
42% identity, 95% coverage: 9:247/252 of query aligns to 3:247/248 of 4iqgD
- active site: G13 (= G19), N112 (≠ D116), S143 (= S144), Y154 (= Y154), Y157 (= Y157), K161 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G15), S11 (≠ A17), R12 (≠ T18), G13 (= G19), I14 (= I20), N32 (= N38), A34 (≠ R40), S35 (≠ D41), N36 (≠ Q42), A59 (= A65), D60 (= D66), V61 (= V67), N87 (= N92), A88 (= A93), G89 (= G94), V141 (= V142), S143 (= S144), Y157 (= Y157), K161 (= K161), P187 (= P187), G188 (= G188), I190 (= I190), T192 (= T192), I194 (≠ M194), H195 (≠ V195)
8jfiC Crystal structure of 3-oxoacyl-acp reductase fabg in complex with NADP+ and 3-keto-hexanoyl-acp from helicobacter pylori (see paper)
38% identity, 98% coverage: 3:250/252 of query aligns to 1:236/236 of 8jfiC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G15), K16 (≠ T18), G17 (= G19), I18 (= I20), R38 (= R40), S39 (≠ D41), D64 (= D66), A65 (≠ V67), N91 (= N92), A92 (= A93), G93 (= G94), V94 (= V95), Y156 (= Y157), K160 (= K161), P186 (= P187), I189 (= I190), T191 (= T192)
- binding : S131 (≠ Q132), K132 (≠ P133), R177 (≠ D178)
Query Sequence
>GFF2310 FitnessBrowser__psRCH2:GFF2310
MGSKRFAGQTALITGAATGIGRATALALAAEGARVWINHRDQHDLANQLVEQITANGGDA
WAIEADVSDPAAVAAMFETIEAQGSLDLLVNNAGVILEKPFLETSEADWAMVLGVDLGGV
YRCCRHALAQMQPRRSGAIVNVASDLGFLGREQYVAYCTAKAGVIGLTRSLAREFAADGI
RVNGVAPGPIATAMVSPEHMSDEWMAKELAIPMARLGTPEEVAAAIVFLLSPQASYFTGQ
LLGPNGGSWMGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory