SitesBLAST
Comparing GFF2311 FitnessBrowser__Marino:GFF2311 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ozbA Crystal structure of 5'-methylthioinosine phosphorylase from psedomonas aeruginosa in complex with hypoxanthine (see paper)
58% identity, 93% coverage: 7:250/262 of query aligns to 1:241/241 of 3ozbA
- active site: T10 (= T16), P33 (= P39), F56 (≠ I65), P57 (= P66), A83 (= A92), M182 (= M191), T183 (= T192), N206 (= N215), A208 (= A217), M218 (= M227)
- binding hypoxanthine: A83 (= A92), V84 (= V93), G85 (= G94), L163 (= L172), E164 (= E173), V180 (= V189), G181 (= G190), M182 (= M191), N206 (= N215)
Q8U2I1 6-oxopurine nucleoside phosphorylase; Purine nucleoside phosphorylase; PNP; PfPNP; EC 2.4.2.1 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 2 papers)
41% identity, 91% coverage: 7:245/262 of query aligns to 1:241/265 of Q8U2I1
- M1 (= M7) modified: Initiator methionine, Removed
- C136 (≠ D140) modified: Disulfide link with 202
- C162 (≠ A166) modified: Disulfide link with 190
- E169 (= E173) mutation to S: Decreases catalytic activity for insosine and allows the enzyme to phosphorolytically cleave MTA with a catalytic efficiency about 4-fold higher than for inosine; when associated with D-211, D-213 and A-223.
- C190 (≠ M194) modified: Disulfide link with 162
- C202 (≠ R206) modified: Disulfide link with 136
- N211 (= N215) mutation to D: Decreases catalytic activity for insosine and allows the enzyme to phosphorolytically cleave MTA with a catalytic efficiency about 4-fold higher than for inosine; when associated with S-169, D-213 and A-223.
- A213 (= A217) mutation to D: Decreases catalytic activity for insosine and allows the enzyme to phosphorolytically cleave MTA with a catalytic efficiency about 4-fold higher than for inosine; when associated with S-169, D-211 and A-223.
- H223 (≠ M227) mutation to A: Decreases catalytic activity for insosine and allows the enzyme to phosphorolytically cleave MTA with a catalytic efficiency about 4-fold higher than for inosine; when associated with S-169, D-211 and D-213.
Sites not aligning to the query:
- 254 modified: Disulfide link with 256; C→S: Fully active, but reduces thermodynamic and kinetic stability of the enzyme; when associated with S-256.
- 256 modified: Disulfide link with 254; C→S: Fully active, but reduces thermodynamic and kinetic stability of the enzyme; when associated with S-254.
3t94A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase (mtap) ii complexed with 5'-deoxy-5'-methylthioadenosine and sulfate (see paper)
38% identity, 90% coverage: 10:245/262 of query aligns to 10:243/270 of 3t94A
- active site: S16 (≠ T16), P39 (= P39), H63 (= H63), I65 (= I65), P66 (= P66), A92 (= A92), M190 (= M191), T191 (= T192), D214 (≠ N215), D216 (≠ A217), A225 (≠ M227)
- binding 5'-deoxy-5'-methylthioadenosine: G94 (= G94), F170 (≠ L172), I188 (≠ V189), M190 (= M191), D214 (≠ N215), A225 (≠ M227), V228 (≠ I230)
Q97W94 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; MTAPII; EC 2.4.2.28 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 2 papers)
38% identity, 90% coverage: 10:245/262 of query aligns to 10:243/270 of Q97W94
- C138 (≠ D140) modified: Disulfide link with 205
- C200 (≠ A201) modified: Disulfide link with 262
- C205 (≠ R206) modified: Disulfide link with 138
Sites not aligning to the query:
- 259 modified: Disulfide link with 261; C→S: Reduces thermostability of the enzyme; when associated with S-261.
- 261 modified: Disulfide link with 259; C→S: Reduces thermostability of the enzyme; when associated with S-259.
- 262 modified: Disulfide link with 200; C→S: Reduces thermostability of the enzyme.
Q8U4Q8 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; PfMTAP; EC 2.4.2.28 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
38% identity, 94% coverage: 7:252/262 of query aligns to 1:240/257 of Q8U4Q8
- C130 (≠ D140) modified: Disulfide link with 195
- C195 (≠ R206) modified: Disulfide link with 130
Sites not aligning to the query:
- 246 modified: Disulfide link with 248
- 248 modified: Disulfide link with 246
1wtaA Crystal structure of 5'-deoxy-5'-methylthioadenosine from aeropyrum pernix (r32 form)
39% identity, 90% coverage: 10:245/262 of query aligns to 12:246/273 of 1wtaA
5f76A Crystal structure of mutant s12t of adenosine/methylthioadenosine phosphorylase from schistosoma mansoni in complex with methylthioadenosine (see paper)
34% identity, 94% coverage: 10:255/262 of query aligns to 4:262/286 of 5f76A
- active site: K32 (≠ M38), H57 (= H63), D228 (≠ N215), D230 (≠ A217)
- binding 5'-deoxy-5'-methylthioadenosine: A86 (= A92), C87 (≠ V93), G88 (= G94), F185 (≠ L172), N203 (≠ G190), M204 (= M191), D228 (≠ N215), V240 (≠ A233)
5f7jB Crystal structure of mutant n87t of adenosine/methylthioadenosine phosphorylase from schistosoma mansoni in complex with adenine (see paper)
33% identity, 94% coverage: 10:255/262 of query aligns to 6:268/291 of 5f7jB
- active site: K34 (≠ M38), H59 (= H63), D230 (≠ N215), D232 (≠ A217)
- binding adenine: A88 (= A92), C89 (≠ V93), G90 (= G94), F187 (≠ L172), V204 (= V189), N205 (≠ G190), M206 (= M191), D230 (≠ N215), D232 (≠ A217), V246 (≠ A233)
4l5aA Methylthioadenosine phosphorylase from schistosoma mansoni in complex with tubercidin (see paper)
34% identity, 93% coverage: 10:253/262 of query aligns to 4:260/282 of 4l5aA
- active site: K29 (≠ M38), H54 (= H63), D225 (≠ N215), D227 (≠ A217)
- binding '2-(4-amino-pyrrolo[2,3-d]pyrimidin-7-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol: A83 (= A92), C84 (≠ V93), G85 (= G94), F182 (≠ L172), N200 (≠ G190), M201 (= M191), V237 (≠ I230)
4gljA Crystal structure of methylthioadenosine phosphorylase in complex with rhodamine b (see paper)
40% identity, 79% coverage: 10:216/262 of query aligns to 6:213/287 of 4gljA
- active site: D212 (≠ N215)
- binding N-[9-(2-carboxyphenyl)-6-(diethylamino)-3H-xanthen-3-ylidene]-N-ethylethanaminium: S12 (≠ T16), Y15 (≠ T19), H55 (= H59), A88 (= A92), G90 (= G94), F169 (≠ L172), F169 (≠ L172), I186 (≠ V189), G187 (= G190), M188 (= M191), D212 (≠ N215), F213 (≠ W216)
Sites not aligning to the query:
5eubA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with 2-amino-mta and sulfate
31% identity, 93% coverage: 10:253/262 of query aligns to 3:250/272 of 5eubA
- active site: T9 (= T16), P32 (= P39), H56 (= H63), I58 (= I65), M59 (≠ P66), A85 (= A92), M187 (= M191), T188 (= T192), D211 (≠ N215), D213 (≠ A217), V224 (≠ M227)
- binding (2~{R},3~{R},4~{S},5~{S})-2-[2,6-bis(azanyl)purin-9-yl]-5-(methylsulfanylmethyl)oxolane-3,4-diol: A85 (= A92), C86 (≠ V93), G87 (= G94), F168 (≠ L172), I185 (≠ V189), N186 (≠ G190), T210 (≠ V214), D211 (≠ N215), D213 (≠ A217), V227 (≠ I230)
6dz3A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-(((3-(1-butyl-1h-1,2,3-triazol-4-yl) propyl)thio)methyl)pyrrolidin-3-ol (see paper)
31% identity, 93% coverage: 10:253/262 of query aligns to 4:251/273 of 6dz3A
- active site: T10 (= T16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M191), T189 (= T192), D212 (≠ N215), D214 (≠ A217), V225 (≠ M227)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-({[3-(1-butyl-1H-1,2,3-triazol-4-yl)propyl]sulfanyl}methyl)pyrrolidin-3-ol: T84 (≠ V90), A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (≠ L172), I186 (≠ V189), N187 (≠ G190), M188 (= M191), D212 (≠ N215), D214 (≠ A217), V228 (≠ I230), L232 (≠ I234)
6dyzA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((prop-2-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
31% identity, 93% coverage: 10:253/262 of query aligns to 4:251/273 of 6dyzA
- active site: T10 (= T16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M191), T189 (= T192), D212 (≠ N215), D214 (≠ A217), V225 (≠ M227)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(prop-2-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (= T16), H57 (= H63), A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (≠ L172), I186 (≠ V189), N187 (≠ G190), M188 (= M191), D212 (≠ N215), D214 (≠ A217), V228 (≠ I230)
- binding phosphate ion: G9 (= G15), T10 (= T16), R52 (= R58), H53 (= H59), T85 (≠ N91), A86 (= A92), T189 (= T192)
5tc8A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with methylthio-dadme-immucillin-a
31% identity, 93% coverage: 10:253/262 of query aligns to 4:251/273 of 5tc8A
- active site: T10 (= T16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M191), T189 (= T192), D212 (≠ N215), D214 (≠ A217), V225 (≠ M227)
- binding (3r,4s)-1-[(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(methylsulfanyl)methyl]pyrrolidin-3-ol: T10 (= T16), A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (≠ L172), I186 (≠ V189), N187 (≠ G190), M188 (= M191), T211 (≠ V214), D212 (≠ N215), D214 (≠ A217), V228 (≠ I230)
5tc6A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with propylthio-immucillin-a
31% identity, 93% coverage: 10:253/262 of query aligns to 4:251/273 of 5tc6A
- active site: T10 (= T16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M191), T189 (= T192), D212 (≠ N215), D214 (≠ A217), V225 (≠ M227)
- binding (2S,3S,4R,5S)-2-(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(propylsulfanyl)methyl]pyrrolidine-3,4-diol: T10 (= T16), A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (≠ L172), N187 (≠ G190), M188 (= M191), D212 (≠ N215), V225 (≠ M227), V228 (≠ I230), L229 (≠ E231)
3ozcA Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase in complex with pcl-phenylthiodadmeimma
31% identity, 93% coverage: 10:253/262 of query aligns to 4:251/273 of 3ozcA
- active site: T10 (= T16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M191), T189 (= T192), D212 (≠ N215), D214 (≠ A217), V225 (≠ M227)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(4-chlorophenyl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (= T16), H57 (= H63), A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (≠ L172), I186 (≠ V189), N187 (≠ G190), M188 (= M191), D212 (≠ N215), D214 (≠ A217), V228 (≠ I230), L229 (≠ E231)
5tc5A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with butylthio-dadme-immucillin-a and chloride
31% identity, 93% coverage: 10:253/262 of query aligns to 17:264/286 of 5tc5A
- active site: T23 (= T16), P46 (= P39), H70 (= H63), I72 (= I65), M73 (≠ P66), A99 (= A92), M201 (= M191), T202 (= T192), D225 (≠ N215), D227 (≠ A217), V238 (≠ M227)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(butylsulfanyl)methyl]pyrrolidin-3-ol: A99 (= A92), C100 (≠ V93), G101 (= G94), F182 (≠ L172), I199 (≠ V189), M201 (= M191), D225 (≠ N215), D227 (≠ A217), V241 (≠ I230)
6dz0A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((pent-4-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
31% identity, 93% coverage: 10:253/262 of query aligns to 6:253/274 of 6dz0A
- active site: T12 (= T16), P35 (= P39), H59 (= H63), I61 (= I65), M62 (≠ P66), A88 (= A92), M190 (= M191), T191 (= T192), D214 (≠ N215), D216 (≠ A217), V227 (≠ M227)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(pent-4-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T12 (= T16), H59 (= H63), A88 (= A92), C89 (≠ V93), G90 (= G94), F171 (≠ L172), I188 (≠ V189), N189 (≠ G190), M190 (= M191), T213 (≠ V214), D214 (≠ N215), D216 (≠ A217), V227 (≠ M227), V230 (≠ I230)
- binding phosphate ion: G11 (= G15), T12 (= T16), R54 (= R58), H55 (= H59), T87 (≠ N91), T191 (= T192)
1k27A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with a transition state analogue (see paper)
31% identity, 93% coverage: 10:253/262 of query aligns to 4:248/270 of 1k27A
- active site: T10 (= T16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M191), T189 (= T192), D212 (≠ N215), D214 (≠ A217), V222 (≠ M227)
- binding (3s,4r)-2-(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(methylsulfanyl)methyl]pyrrolidine-3,4-diol: A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (≠ L172), N187 (≠ G190), M188 (= M191), D212 (≠ N215), V225 (≠ I230)
- binding phosphate ion: G9 (= G15), T10 (= T16), R52 (= R58), H53 (= H59), T85 (≠ N91), A86 (= A92), T189 (= T192)
1sd1A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with formycin a (see paper)
31% identity, 93% coverage: 10:253/262 of query aligns to 4:246/268 of 1sd1A
- active site: T10 (= T16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M191), T189 (= T192), D212 (≠ N215), D214 (≠ A217), V220 (≠ M227)
- binding (1S)-1-(7-amino-1H-pyrazolo[4,3-d]pyrimidin-3-yl)-1,4-anhydro-D-ribitol: A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (≠ L172), I186 (≠ V189), N187 (≠ G190), M188 (= M191), D212 (≠ N215), D214 (≠ A217)
Query Sequence
>GFF2311 FitnessBrowser__Marino:GFF2311
MTSPEKMHPVGIIGGTGLTTLSGLEITGENKAGTPWGMPSAPLVEGRLGDQPVMFLSRHG
NPHRIPPHQVNYRANLKALYDAGVRTVVGVNAVGGIHADMGPAHVVIPDQIIDYTWGRAS
TFFEGSLDSVTHIDFTWPYDESARQILIDAAGAENVPFSGFGVYGATQGPRLETAAEIIR
MERDGCDLVGMTGMPEAALAAELGMRYVCLGLVVNWAAGKSDHIITMEEIEAAIEQGMSG
VKRILEVSMAGLGVLTPLPQSS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory