SitesBLAST
Comparing GFF2313 FitnessBrowser__WCS417:GFF2313 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
25% identity, 83% coverage: 31:385/430 of query aligns to 25:364/383 of 5i39A
- active site: F66 (≠ N72), Q69 (= Q75), A70 (≠ L76), Q248 (vs. gap), P267 (= P276)
- binding flavin-adenine dinucleotide: V30 (≠ I36), G31 (= G37), G33 (= G39), I34 (≠ F40), L35 (≠ T41), V53 (≠ L59), E54 (= E60), K55 (≠ A61), Q62 (≠ A68), S63 (= S69), F66 (≠ N72), Y67 (≠ G73), Q69 (= Q75), A196 (≠ E210), A197 (≠ V211), G226 (≠ C238), G227 (≠ N239), W229 (≠ H241), Q248 (vs. gap), Q250 (≠ S258), G321 (= G341), M323 (≠ I343), T348 (≠ S369), G349 (= G370), W350 (≠ H371), G351 (= G372), M352 (≠ L373), T353 (≠ N374)
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
21% identity, 80% coverage: 48:392/430 of query aligns to 22:356/374 of 1y56B
- active site: F44 (≠ G70), G47 (= G73), T48 (≠ G74), H224 (≠ S258), P239 (≠ Q273), G305 (= G341), M338 (≠ N374)
- binding flavin-adenine dinucleotide: I33 (≠ L59), E34 (= E60), K35 (≠ A61), S42 (≠ A68), T43 (≠ S69), R45 (= R71), C46 (≠ N72), G47 (= G73), G49 (≠ Q75), E170 (= E210), V171 (= V211), T200 (≠ C238), N201 (= N239), W203 (≠ H241), G305 (= G341), Y306 (≠ K342), Y307 (≠ I343), G334 (= G370), H335 (= H371), G336 (= G372), F337 (≠ L373), M338 (≠ N374)
- binding flavin mononucleotide: F44 (≠ G70), R45 (= R71), I260 (≠ D296), R301 (≠ F337), W303 (= W339)
Sites not aligning to the query:
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
28% identity, 48% coverage: 31:237/430 of query aligns to 17:217/433 of 5hxwA
- active site: F58 (≠ N72), Q61 (= Q75), A62 (≠ L76)
- binding flavin-adenine dinucleotide: V22 (≠ I36), G23 (= G37), G25 (= G39), I26 (≠ F40), L27 (≠ T41), E46 (= E60), K47 (≠ A61), E53 (≠ G67), Q54 (≠ A68), S55 (= S69), R57 (= R71), F58 (≠ N72), Y59 (≠ G73), G60 (= G74), Q61 (= Q75), A188 (≠ E210), A189 (≠ V211)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 218, 219, 221, 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
Query Sequence
>GFF2313 FitnessBrowser__WCS417:GFF2313
MIQSTDHARSYYRATANALTERPALGTDLTADVCVIGGGFTGVNTAIELAQRGLSVVLLE
ARRIGWGASGRNGGQLIRGIGHDVSGFGKYVGEEGVRYLERAGIDSVALVGERIRTHRID
CDLRWGFCELANTPAQFAAFKGEQAHLAALGYAHETRLVGPQDIQQVVGSPVYAGGLVDM
GSGHLHPLNLVLGEARLAESLGVRIFEHTEVLELIHGDTVHVRCAGGTVRAASLVLACNA
HLEELEPRLSGKVLPAGSYIIATEPLSADLANQLIPQNLALCDQKVGLDYYRLSADRRLL
FGGACHYSGRDPADIAAYMQPKMLKVFPQLANTAIEFQWGGKIGITANRFPQVGRLKQYP
NVFYAQGYSGHGLNVTHWCARLLAEAIQAGHSTGLDIFSQVPHMTFPGGKALRSPLLALG
MLWYRLRELI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory