Comparing GFF2315 FitnessBrowser__WCS417:GFF2315 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7svqA Crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with NAD+ (see paper)
27% identity, 89% coverage: 11:307/334 of query aligns to 17:281/315 of 7svqA
7eziA Rice l-galactose dehydrogenase (apo form)
29% identity, 90% coverage: 11:310/334 of query aligns to 23:290/323 of 7eziA
7ezlA Rice l-galactose dehydrogenase (holo form)
29% identity, 90% coverage: 11:310/334 of query aligns to 18:285/318 of 7ezlA
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
27% identity, 90% coverage: 11:312/334 of query aligns to 15:296/311 of 1pz0A
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
27% identity, 90% coverage: 11:312/334 of query aligns to 16:297/310 of P46336
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
27% identity, 90% coverage: 10:311/334 of query aligns to 16:274/298 of 1ynqB
Sites not aligning to the query:
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
27% identity, 90% coverage: 10:311/334 of query aligns to 16:274/298 of 1ynpB
Sites not aligning to the query:
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
25% identity, 91% coverage: 9:311/334 of query aligns to 15:259/283 of 1ynpA
Sites not aligning to the query:
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
25% identity, 93% coverage: 11:322/334 of query aligns to 23:319/326 of P77256
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
27% identity, 97% coverage: 10:332/334 of query aligns to 15:311/337 of Q3L181
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
27% identity, 96% coverage: 10:331/334 of query aligns to 15:278/287 of 3v0sA
4exaF Crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa (see paper)
30% identity, 81% coverage: 11:280/334 of query aligns to 26:259/259 of 4exaF
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
26% identity, 91% coverage: 10:312/334 of query aligns to 27:277/286 of 8hnqA
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
24% identity, 90% coverage: 10:310/334 of query aligns to 15:292/333 of 1pz1A
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
24% identity, 90% coverage: 10:310/334 of query aligns to 15:292/331 of P80874
8hw0A The structure of akr6d1
23% identity, 84% coverage: 29:309/334 of query aligns to 32:302/329 of 8hw0A
Sites not aligning to the query:
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
24% identity, 83% coverage: 19:295/334 of query aligns to 19:263/301 of 6ow0B
Sites not aligning to the query:
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
25% identity, 86% coverage: 26:311/334 of query aligns to 29:299/323 of 6ow0A
Sites not aligning to the query:
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 34% coverage: 27:139/334 of query aligns to 43:156/351 of Q9P7U2
3d3fA Crystal structure of yvgn and cofactor NADPH from bacillus subtilis (see paper)
24% identity, 91% coverage: 2:304/334 of query aligns to 3:241/275 of 3d3fA
>GFF2315 FitnessBrowser__WCS417:GFF2315
MSLKDKLPGQLGFGTAPLGNMFRAIPEDEAQATVEAAWNAGVRYFDTAPFYGSGLSEIRL
GHALSQYNRDDFVLSTKVGRVILDEIEDSARDLGEKSGVFEHGRPNKMLNDYSADATLRS
IEDSLTRLNTDRLDIVWIHDIAQDFYGDQWLEYFNQARTGAFKVLTRLREEGVIKAWGLG
VNRVEPCELTLDLTEAQPDGFLLAGRYTLLDHDRALQRLMDAALAQNVEIVVGGPYSSGI
LAGGAHFEYQQASPAIIRKVEQIRAIAQAFGVSVKAAALQFSLAHPAVAAVIPGASRPGR
IAEDVAALSETIPAAFWQALREARLISDRAPLPL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory