SitesBLAST
Comparing GFF2316 FitnessBrowser__Phaeo:GFF2316 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
40% identity, 97% coverage: 7:255/257 of query aligns to 3:257/261 of 6zzsD
- active site: G18 (= G22), S143 (= S142), Y156 (= Y155)
- binding nicotinamide-adenine-dinucleotide: G14 (= G18), S17 (= S21), I19 (≠ V23), D38 (≠ G42), M39 (≠ R43), D64 (= D63), V65 (= V64), N91 (= N90), A92 (= A91), G93 (= G92), M141 (≠ V140), A142 (= A141), S143 (= S142), Y156 (= Y155), K160 (= K159), P186 (= P185), G187 (= G186), V189 (≠ I188), T191 (= T190), L193 (= L192)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ A94), S143 (= S142), N145 (≠ A144), K153 (≠ V152), Y156 (= Y155), Q197 (≠ S196)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
40% identity, 97% coverage: 7:255/257 of query aligns to 2:256/260 of 6zzqA
- active site: G17 (= G22), S142 (= S142), Y155 (= Y155)
- binding acetoacetic acid: Q94 (≠ A94), S142 (= S142), K152 (≠ V152), Y155 (= Y155), Q196 (≠ S196)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), S16 (= S21), G17 (= G22), I18 (≠ V23), D37 (≠ G42), M38 (≠ R43), D63 (= D63), V64 (= V64), N90 (= N90), A91 (= A91), G92 (= G92), M140 (≠ V140), A141 (= A141), S142 (= S142), Y155 (= Y155), K159 (= K159), Y187 (≠ F187), V188 (≠ I188), T190 (= T190)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
40% identity, 96% coverage: 9:255/257 of query aligns to 2:256/260 of 2ztlA
- active site: G15 (= G22), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), L200 (≠ I200)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ A94), S142 (= S142), H144 (≠ A144), K152 (≠ V152), Y155 (= Y155), Q196 (≠ S196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), G15 (= G22), I16 (≠ V23), F36 (vs. gap), L64 (≠ V64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (≠ V113), Y155 (= Y155), K159 (= K159), P185 (= P185), W187 (≠ F187), V188 (≠ I188), T190 (= T190), V193 (≠ L193)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
40% identity, 96% coverage: 9:255/257 of query aligns to 2:256/260 of 1wmbA
Sites not aligning to the query:
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
39% identity, 96% coverage: 9:255/257 of query aligns to 2:256/260 of 5b4tA
- active site: G15 (= G22), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (= I200)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ A94), S142 (= S142), H144 (≠ A144), K152 (≠ V152), Y155 (= Y155), W187 (≠ F187), Q196 (≠ S196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), T13 (≠ G20), G15 (= G22), I16 (≠ V23), F36 (vs. gap), D63 (= D63), L64 (≠ V64), N90 (= N90), G92 (= G92), L113 (≠ V113), I140 (≠ V140), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), W187 (≠ F187), V188 (≠ I188), T190 (= T190), L192 (= L192), V193 (≠ L193)
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
39% identity, 96% coverage: 9:255/257 of query aligns to 2:256/260 of 3w8dA
- active site: G15 (= G22), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (= I200)
- binding methylmalonic acid: Q94 (≠ A94), S142 (= S142), H144 (≠ A144), K152 (≠ V152), Y155 (= Y155), W187 (≠ F187), Q196 (≠ S196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), T13 (≠ G20), S14 (= S21), G15 (= G22), I16 (≠ V23), F36 (vs. gap), A62 (≠ C62), D63 (= D63), L64 (≠ V64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (≠ V113), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), W187 (≠ F187), V188 (≠ I188), T190 (= T190), L192 (= L192), V193 (≠ L193)
Sites not aligning to the query:
3vdrA Crystal structure of d-3-hydroxybutyrate dehydrogenase, prepared in the presence of the substrate d-3-hydroxybutyrate and NAD(+) (see paper)
39% identity, 96% coverage: 9:255/257 of query aligns to 2:256/260 of 3vdrA
- active site: G15 (= G22), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (= I200)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ A94), H144 (≠ A144), K152 (≠ V152), Y155 (= Y155), W187 (≠ F187), Q196 (≠ S196)
- binding acetoacetic acid: Q94 (≠ A94), H144 (≠ A144), K152 (≠ V152), Y155 (= Y155), W187 (≠ F187), Q196 (≠ S196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), T13 (≠ G20), I16 (≠ V23), F36 (vs. gap), D63 (= D63), L64 (≠ V64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (≠ V113), K159 (= K159), G186 (= G186), V188 (≠ I188), T190 (= T190), L192 (= L192), V193 (≠ L193)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G18), T13 (≠ G20), I16 (≠ V23), F36 (vs. gap), D63 (= D63), L64 (≠ V64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (≠ V113), S142 (= S142), Y155 (= Y155), K159 (= K159), G186 (= G186), V188 (≠ I188), T190 (= T190), L192 (= L192), V193 (≠ L193)
Sites not aligning to the query:
3vdqA Crystal structure of alcaligenes faecalis d-3-hydroxybutyrate dehydrogenase in complex with NAD(+) and acetate (see paper)
39% identity, 96% coverage: 9:255/257 of query aligns to 2:256/260 of 3vdqA
- active site: G15 (= G22), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (= I200)
- binding acetate ion: Q94 (≠ A94), H144 (≠ A144), K152 (≠ V152), W187 (≠ F187), L192 (= L192), Q196 (≠ S196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), S14 (= S21), I16 (≠ V23), F36 (vs. gap), D63 (= D63), L64 (≠ V64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (≠ V113), I140 (≠ V140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), W187 (≠ F187), V188 (≠ I188), T190 (= T190), L192 (= L192), V193 (≠ L193)
3sjuA Hedamycin polyketide ketoreductase bound to NADPH (see paper)
39% identity, 93% coverage: 16:255/257 of query aligns to 5:251/255 of 3sjuA
- active site: G11 (= G22), S138 (= S142), Y151 (= Y155), K155 (= K159), Y196 (≠ I200)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G18), S10 (= S21), A31 (≠ G42), R32 (= R43), D33 (≠ P47), C56 (= C62), D57 (= D63), V58 (= V64), S84 (≠ N90), A85 (= A91), G86 (= G92), I136 (≠ V140), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), Y183 (≠ F187), V184 (≠ I188), T186 (= T190), M188 (≠ L192)
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
36% identity, 97% coverage: 8:257/257 of query aligns to 1:253/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), T13 (≠ G20), S14 (= S21), G15 (= G22), I16 (≠ V23), G35 (= G42), F36 (≠ R43), L60 (≠ V64), N86 (= N90), G88 (= G92), I89 (≠ A93), A137 (= A141), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), V184 (≠ I188), T186 (= T190)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 96% coverage: 9:255/257 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G22), N111 (= N114), S139 (= S142), Q149 (≠ V152), Y152 (= Y155), K156 (= K159)
- binding acetoacetyl-coenzyme a: D93 (≠ S96), K98 (= K101), S139 (= S142), N146 (≠ Y149), V147 (≠ P150), Q149 (≠ V152), Y152 (= Y155), F184 (= F187), M189 (≠ L192), K200 (≠ S214)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), N17 (≠ S21), G18 (= G22), I19 (≠ V23), D38 (≠ G42), F39 (≠ R43), V59 (≠ C62), D60 (= D63), V61 (= V64), N87 (= N90), A88 (= A91), G89 (= G92), I90 (≠ A93), T137 (≠ V140), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), F184 (= F187), T185 (≠ I188), T187 (= T190), M189 (≠ L192)
1x1tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with NAD+ (see paper)
38% identity, 96% coverage: 9:255/257 of query aligns to 2:232/236 of 1x1tA
- active site: G15 (= G22), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding cacodylate ion: S142 (= S142), H144 (≠ A144), Y155 (= Y155), W187 (≠ F187)
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), T13 (≠ G20), S14 (= S21), G15 (= G22), I16 (≠ V23), G35 (= G42), F36 (vs. gap), D63 (= D63), L64 (≠ V64), N90 (= N90), G92 (= G92), L113 (≠ V113), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), W187 (≠ F187), V188 (≠ I188), T190 (= T190)
Sites not aligning to the query:
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
34% identity, 96% coverage: 8:255/257 of query aligns to 4:251/255 of 5itvA
- active site: G18 (= G22), S141 (= S142), Y154 (= Y155), K158 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), S17 (= S21), G18 (= G22), I19 (≠ V23), D38 (≠ P47), I39 (≠ L48), T61 (≠ C62), I63 (≠ V64), N89 (= N90), G91 (= G92), T139 (≠ V140), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), I186 (≠ F187), I187 (= I188)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
34% identity, 97% coverage: 9:257/257 of query aligns to 2:253/255 of 2q2qD
- active site: G15 (= G22), S138 (= S142), Y151 (= Y155), K155 (= K159), R196 (≠ I200)
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), T13 (≠ G20), S14 (= S21), G15 (= G22), I16 (≠ V23), F36 (≠ L41), D59 (= D63), L60 (≠ V64), N86 (= N90), G88 (= G92), L109 (≠ V113), I136 (≠ V140), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), W183 (≠ F187), V184 (≠ I188), T186 (= T190), L188 (= L192), V189 (≠ L193)
1xr3A Actinorhodin polyketide ketoreductase with NADP and the inhibitor isoniazid bound (see paper)
36% identity, 94% coverage: 15:255/257 of query aligns to 5:252/256 of 1xr3A
- active site: G12 (= G22), N109 (= N114), S139 (= S142), Y152 (= Y155), K156 (= K159), Y197 (≠ I200)
- binding 4-(diazenylcarbonyl)pyridine: T140 (= T143), G141 (≠ A144), V146 (≠ Y149)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), T10 (≠ G20), S11 (= S21), G12 (= G22), I13 (≠ V23), A32 (≠ G42), R33 (= R43), G34 (≠ R44), C57 (= C62), D58 (= D63), V59 (= V64), N85 (= N90), A86 (= A91), G87 (= G92), S139 (= S142), Y152 (= Y155), K156 (= K159), G183 (= G186), V185 (≠ I188), T187 (= T190), P188 (= P191)
P16544 Putative ketoacyl reductase; EC 1.3.1.- from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
36% identity, 94% coverage: 15:255/257 of query aligns to 10:257/261 of P16544
- 11:39 (vs. 16:44, 38% identical) binding
- D63 (= D63) binding
- K161 (= K159) binding
2rh4B Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
36% identity, 94% coverage: 15:255/257 of query aligns to 17:264/268 of 2rh4B
- active site: G24 (= G22), N121 (= N114), S151 (= S142), Y164 (= Y155), K168 (= K159), Y209 (≠ I200)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G18), T22 (≠ G20), S23 (= S21), I25 (≠ V23), A44 (≠ G42), R45 (= R43), G46 (≠ R44), C69 (= C62), D70 (= D63), V71 (= V64), N97 (= N90), S151 (= S142), Y164 (= Y155), K168 (= K159), G195 (= G186), V197 (≠ I188), T199 (= T190), M201 (≠ L192)
1w4zA Structure of actinorhodin polyketide (actiii) reductase (see paper)
36% identity, 94% coverage: 15:255/257 of query aligns to 8:255/259 of 1w4zA
- active site: G15 (= G22), N112 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), Y200 (≠ I200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G18), T13 (≠ G20), S14 (= S21), G15 (= G22), I16 (≠ V23), R36 (= R43), G37 (≠ R44), D61 (= D63), V62 (= V64), N88 (= N90), G90 (= G92), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), V188 (≠ I188), T190 (= T190)
2rh4A Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
36% identity, 94% coverage: 15:255/257 of query aligns to 6:253/257 of 2rh4A
- active site: G13 (= G22), N110 (= N114), S140 (= S142), Y153 (= Y155), K157 (= K159), Y198 (≠ I200)
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: T141 (= T143), Q145 (≠ K147), V147 (≠ Y149), Y153 (= Y155), F185 (= F187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G18), T11 (≠ G20), S12 (= S21), G13 (= G22), I14 (≠ V23), A33 (≠ G42), R34 (= R43), G35 (≠ R44), C58 (= C62), D59 (= D63), V60 (= V64), N86 (= N90), G88 (= G92), S140 (= S142), Y153 (= Y155), K157 (= K159), P183 (= P185), G184 (= G186), V186 (≠ I188), T188 (= T190), M190 (≠ L192)
Sites not aligning to the query:
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
35% identity, 96% coverage: 8:255/257 of query aligns to 4:254/258 of 3ak4A
- active site: G18 (= G22), S141 (= S142), L151 (≠ V152), Y154 (= Y155), K158 (= K159), E199 (≠ I200)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ S21), G18 (= G22), I19 (≠ V23), D38 (≠ G42), L39 (≠ R43), V60 (≠ C62), D61 (= D63), V62 (= V64), N88 (= N90), A89 (= A91), G90 (= G92), T139 (≠ V140), S141 (= S142), Y154 (= Y155), K158 (= K159), G185 (= G186), V187 (≠ I188), T189 (= T190), M191 (≠ L192)
Query Sequence
>GFF2316 FitnessBrowser__Phaeo:GFF2316
MSNLAGKDLAGRHVVVTGGGSGVGAALARSFAGGGARLTLLGRRIEPLQEVAAETGALPL
ACDVTEAEAVRAALDTARQQHGPVSVAIANAGAAPSKPFAKMDLADFEAALAVNLSGVFN
LWQAALPDMKSAGWGRMIAVASTAGLKGYPYVSGYCAAKHGVVGLTRSLAQELARSGITV
NAICPGFIETPLLERSIATIVSTTGMSEEEAAKSLRAGNPQGRFIQPEEVADAALFLASS
SAASINGSALPITGGEI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory