Comparing GFF2332 FitnessBrowser__WCS417:GFF2332 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
50% identity, 95% coverage: 23:512/517 of query aligns to 4:493/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 42% coverage: 23:239/517 of query aligns to 2:214/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 40% coverage: 28:236/517 of query aligns to 6:212/240 of 4ymuJ
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 42% coverage: 23:239/517 of query aligns to 1:207/348 of 3d31A
Sites not aligning to the query:
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
33% identity, 41% coverage: 24:236/517 of query aligns to 4:214/350 of 3fvqB
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 42% coverage: 23:239/517 of query aligns to 3:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 42% coverage: 23:239/517 of query aligns to 3:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 42% coverage: 23:239/517 of query aligns to 3:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 42% coverage: 23:239/517 of query aligns to 3:216/242 of 2oljA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 43% coverage: 23:245/517 of query aligns to 4:235/254 of 1g6hA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
27% identity, 58% coverage: 24:325/517 of query aligns to 7:296/375 of 2d62A
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 43% coverage: 23:245/517 of query aligns to 4:235/253 of 1g9xB
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 44% coverage: 8:236/517 of query aligns to 9:224/378 of P69874
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
29% identity, 41% coverage: 288:498/517 of query aligns to 19:230/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
30% identity, 41% coverage: 288:498/517 of query aligns to 19:230/250 of 7z18I
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 42% coverage: 23:239/517 of query aligns to 1:220/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 42% coverage: 22:239/517 of query aligns to 1:221/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 42% coverage: 22:239/517 of query aligns to 1:221/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 42% coverage: 22:239/517 of query aligns to 1:221/344 of 3tuiC
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
30% identity, 41% coverage: 288:498/517 of query aligns to 19:230/250 of 7z16I
Sites not aligning to the query:
>GFF2332 FitnessBrowser__WCS417:GFF2332
MLAQATVSQPPSLQPQTLEEPYLLEIVNISKGFPGVVALADVQLRVRPGTVLALMGENGA
GKSTLMKIIAGIYQPDAGEIRLRGKPIVFETPLAAQKAGIAMIHQELNLMPHMSIAENIW
IGREQLNSLHMVNHREMHRCTAELLARLRINLDPEEQVGNLSIAERQMVEIAKAVSYDSD
ILIMDEPTSAITEKEVAHLFSIIADLKSQGKGIVYITHKMNEVFAIADEVAVFRDGHYIG
LQRADSMNSDSLISMMVGRELSQLFPLRETPIGDLLLTVRDLTLDGVFKDVSFDLHAGEI
LGIAGLMGSGRTNVAETIFGITPSSSGQITLDGKAVRISDPHMAIEKGFALLTEDRKLSG
LFPCLSVLENMEMAVLPHYTGNGFIQQKALRALCEDMCKKLRVKTPSLEQCIDTLSGGNQ
QKALLARWLMTNPRLLILDEPTRGIDVGAKAEIYRLIAFLASEGMAVIMISSELPEVLGM
SDRVMVMHEGELMGTLDRSEATQEKVMQLASGMTAVH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory