SitesBLAST
Comparing GFF2360 FitnessBrowser__WCS417:GFF2360 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q9CIV7 PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
36% identity, 88% coverage: 21:209/215 of query aligns to 18:191/192 of Q9CIV7
- D29 (= D32) binding
- D34 (= D37) binding
- D36 (= D39) binding
- HGAN 37:40 (≠ HGIN 40:43) binding
- AS 78:79 (≠ SM 80:81) binding
- R114 (≠ I121) mutation to A: Reduces activity 3-fold.; mutation to E: Reduces activity 100-fold.
- G115 (≠ T122) binding
- M124 (≠ L131) binding
- R161 (= R179) mutation to A: Loss of activity.
- Y164 (≠ R182) mutation to A: Reduces activity about 20-fold.
- DPG 174:176 (≠ DAG 192:194) binding
3cr3A Structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis (see paper)
36% identity, 88% coverage: 21:209/215 of query aligns to 18:191/192 of 3cr3A
- binding adenosine-5'-diphosphate: D29 (= D32), D34 (= D37), D36 (= D39), H37 (= H40), N40 (= N43), G77 (= G79), A78 (≠ S80), S79 (≠ M81), L82 (= L84), G115 (≠ T122), A117 (= A124), T123 (≠ C130), D174 (= D192), P175 (≠ A193), G176 (= G194)
- binding magnesium ion: D29 (= D32), D34 (= D37), D34 (= D37), D36 (= D39), D36 (= D39)
4lrzA Crystal structure of the e.Coli dhar(n)-dhal complex (see paper)
34% identity, 84% coverage: 26:206/215 of query aligns to 25:206/211 of 4lrzA
- binding adenosine-5'-diphosphate: D31 (= D32), D36 (= D37), D38 (= D39), H39 (= H40), G79 (= G79), A80 (≠ S80), S81 (≠ M81), L84 (= L84), G122 (≠ T122), T130 (≠ C130), M131 (≠ L131), G178 (= G178), D192 (= D192), P193 (≠ A193), G194 (= G194)
- binding magnesium ion: D31 (= D32), D36 (= D37), D36 (= D37), D38 (= D39), D38 (= D39)
P76014 PEP-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 84% coverage: 26:206/215 of query aligns to 24:205/210 of P76014
Q3LXA3 Triokinase/FMN cyclase; Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); EC 2.7.1.28; EC 2.7.1.29; EC 4.6.1.15 from Homo sapiens (Human) (see 4 papers)
28% identity, 85% coverage: 13:194/215 of query aligns to 377:558/575 of Q3LXA3
- D401 (= D37) mutation to A: Abolishes both kinase and FMN cyclase activities.
- D403 (= D39) mutation to A: Abolishes both kinase and FMN cyclase activities.
- C404 (≠ H40) mutation to A: Decreases both kinase and FMN cyclase activities.
- G445 (= G79) to S: in TKFCD; very severe decrease of triokinase and glycerone kinase activities; dbSNP:rs1590578831
- S446 (= S80) mutation to A: Decreases both kinase and FMN cyclase activities.
- R543 (= R179) to I: in TKFCD; reduced protein levels in patient cells; very severe decrease of triokinase and glycerone kinase activities; dbSNP:rs547013163
- D556 (= D192) mutation to A: Abolishes both kinase and FMN cyclase activities.
Sites not aligning to the query:
- 112 T→A: Highly decreases kinase activity. No effect on FMN cyclase activity.
- 185 A → T: in dbSNP:rs2260655
- 204 K→A: Slightly decreases kinase activity. No effect on FMN cyclase activity.
- 221 H→A: Abolishes kinase activity but not FMN cyclase activity.
Query Sequence
>GFF2360 FitnessBrowser__WCS417:GFF2360
MSQYFSTRDGGAIVSDLVSVIVANREYLSEIDGAIGDGDHGINMAKGFAHCGRTLEGRQL
TLAEALDELTLSLMEGIGGSMGPLYGSLFIGMADEVRNSDDIDAATFAHLLRGGLTSLQD
ITEAGVGDKCLMDTLIPAVEAFEQAHATGASFSEALDAMKAAASQGRDSTKDLVAKIGRA
SRLGERSLGVLDAGAVSCCLILTRLADSVQPRLSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory