SitesBLAST
Comparing GFF2363 FitnessBrowser__WCS417:GFF2363 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
38% identity, 95% coverage: 11:249/251 of query aligns to 8:251/258 of 4wecA
- active site: G21 (= G24), S143 (= S145), Q154 (≠ H155), Y157 (= Y158), K161 (= K162)
- binding nicotinamide-adenine-dinucleotide: G17 (= G20), A19 (= A22), S20 (≠ A23), G21 (= G24), I22 (= I25), D41 (= D44), I42 (≠ R45), V61 (= V65), D62 (= D66), V63 (≠ L67), N89 (≠ S93), T141 (≠ L143), Y157 (= Y158), K161 (= K162), P187 (= P187), P189 (≠ I189), V190 (= V190)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 94% coverage: 11:247/251 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G24), S142 (= S145), Q152 (≠ H155), Y155 (= Y158), K159 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (≠ A22), R15 (≠ A23), G16 (= G24), I17 (= I25), N35 (vs. gap), Y36 (≠ L43), N37 (≠ D44), G38 (≠ R45), S39 (≠ D46), N63 (≠ G71), V64 (vs. gap), N90 (≠ S93), A91 (= A94), I93 (≠ V96), I113 (= I116), S142 (= S145), Y155 (= Y158), K159 (= K162), P185 (= P187), I188 (≠ V190), T190 (= T192)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
33% identity, 96% coverage: 7:248/251 of query aligns to 4:244/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G20), D19 (≠ A22), L22 (≠ I25), I42 (vs. gap), D65 (= D66), M66 (≠ L67), N92 (≠ S93), A93 (= A94), G94 (= G95), L115 (≠ I116), I143 (≠ L143), S145 (= S145), Y158 (= Y158), K162 (= K162), G189 (≠ T188), M191 (≠ V190), T193 (= T192), N195 (≠ E202)
3d3wA Structure of l-xylulose reductase with bound coenzyme, phosphate and hydroxide. (see paper)
35% identity, 95% coverage: 11:248/251 of query aligns to 5:241/244 of 3d3wA
- active site: G18 (= G24), S136 (= S145), H146 (= H155), Y149 (= Y158), K153 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G20), G16 (≠ A22), K17 (≠ A23), G18 (= G24), I19 (= I25), S38 (≠ D44), R39 (= R45), T40 (≠ D46), V59 (= V65), L61 (= L67), N83 (≠ S93), A84 (= A94), A85 (≠ G95), V106 (≠ I116), V134 (≠ L143), S135 (≠ A144), S136 (= S145), Y149 (= Y158), K153 (= K162), P179 (= P187), T180 (= T188), V182 (= V190), T184 (= T192), S185 (≠ A193), M186 (≠ L194), G187 (= G195)
1pr9A Human l-xylulose reductase holoenzyme (see paper)
35% identity, 95% coverage: 11:248/251 of query aligns to 5:241/244 of 1pr9A
- active site: G18 (= G24), S136 (= S145), H146 (= H155), Y149 (= Y158), K153 (= K162)
- binding dihydrogenphosphate ion: S136 (= S145), C138 (≠ A147)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G20), G16 (≠ A22), K17 (≠ A23), G18 (= G24), I19 (= I25), S38 (≠ D44), R39 (= R45), T40 (≠ D46), L61 (= L67), N83 (≠ S93), A85 (≠ G95), V106 (≠ I116), V134 (≠ L143), Y149 (= Y158), K153 (= K162), T180 (= T188), V182 (= V190), T184 (= T192), M186 (≠ L194)
Q7Z4W1 L-xylulose reductase; XR; Carbonyl reductase II; Dicarbonyl/L-xylulose reductase; Kidney dicarbonyl reductase; kiDCR; Short chain dehydrogenase/reductase family 20C member 1; Sperm surface protein P34H; EC 1.1.1.10 from Homo sapiens (Human) (see 2 papers)
35% identity, 95% coverage: 11:248/251 of query aligns to 5:241/244 of Q7Z4W1
- 11:40 (vs. 17:46, 37% identical) binding
- N107 (= N117) mutation N->L,D: Loss of function. Probably due to defects in formation of the active site and binding of coenzyme.
- S136 (= S145) binding
- K153 (= K162) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
36% identity, 97% coverage: 9:251/251 of query aligns to 3:258/258 of 3ak4A
- active site: G18 (= G24), S141 (= S145), L151 (≠ H155), Y154 (= Y158), K158 (= K162), E199 (≠ A200)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ A23), G18 (= G24), I19 (= I25), D38 (= D44), L39 (≠ R45), V60 (= V65), D61 (= D66), V62 (≠ L67), N88 (≠ S93), A89 (= A94), G90 (= G95), T139 (≠ L143), S141 (= S145), Y154 (= Y158), K158 (= K162), G185 (≠ T188), V187 (= V190), T189 (= T192), M191 (≠ L194)
Q920P0 L-xylulose reductase; XR; Dicarbonyl/L-xylulose reductase; EC 1.1.1.10 from Rattus norvegicus (Rat) (see paper)
35% identity, 95% coverage: 11:248/251 of query aligns to 5:241/244 of Q920P0
- S136 (= S145) mutation to A: Loss of activity.
- Q137 (= Q146) mutation to M: Slightly reduced activity. Loss of activity for sugars; when associated with F-143 and L-146.
- L143 (= L152) mutation to F: Slightly reduced activity. Loss of activity for sugars; when associated with M-137 and L-146.
- H146 (= H155) mutation to L: Slightly reduced activity. Loss of activity for sugars; when associated with M-137; F-143 and L-146.
- Y149 (= Y158) mutation to F: Loss of activity.
- K153 (= K162) mutation to M: Loss of activity.
- N190 (≠ A198) mutation to V: Slightly reduced activity. Loss of activity for sugars; when associated with S-191.
- W191 (= W199) mutation to F: Slightly reduced activity.; mutation to S: Slightly reduced activity. Loss of activity for sugars; when associated with V-190.
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
38% identity, 96% coverage: 9:248/251 of query aligns to 4:243/246 of 4hp8B
- active site: G19 (= G24), S138 (= S145), V148 (≠ H155), Y151 (= Y158), K155 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), N17 (≠ A22), T18 (≠ A23), G19 (= G24), L20 (≠ I25), R40 (= R45), R41 (vs. gap), D63 (= D66), F64 (≠ L67), N85 (≠ S93), G87 (= G95), I88 (≠ V96), I136 (≠ L143), Y151 (= Y158), K155 (= K162), P181 (= P187), G182 (≠ T188), I184 (≠ V190), T186 (= T192), N188 (≠ L194), T189 (≠ G195)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
38% identity, 96% coverage: 9:248/251 of query aligns to 3:246/249 of 3uf0A
- active site: G18 (= G24), S141 (= S145), V151 (≠ H155), Y154 (= Y158), K158 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G20), S17 (≠ A23), G18 (= G24), I19 (= I25), R39 (= R45), D63 (= D66), L64 (= L67), N89 (≠ S93), G91 (= G95), I92 (≠ V96), I139 (≠ L143), A140 (= A144), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P187), G185 (≠ T188), V187 (= V190), T189 (= T192), N191 (≠ L194), T192 (≠ G195)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 94% coverage: 11:247/251 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G24), N111 (= N117), S139 (= S145), Q149 (≠ H155), Y152 (= Y158), K156 (= K162)
- binding acetoacetyl-coenzyme a: D93 (≠ L99), K98 (≠ D104), S139 (= S145), N146 (≠ L152), V147 (≠ D153), Q149 (≠ H155), Y152 (= Y158), F184 (≠ I189), M189 (≠ L194), K200 (= K206)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G20), N17 (≠ A23), G18 (= G24), I19 (= I25), D38 (= D44), F39 (≠ R45), V59 (= V65), D60 (= D66), V61 (≠ L67), N87 (≠ S93), A88 (= A94), G89 (= G95), I90 (≠ V96), T137 (≠ L143), S139 (= S145), Y152 (= Y158), K156 (= K162), P182 (= P187), F184 (≠ I189), T185 (≠ V190), T187 (= T192), M189 (≠ L194)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
33% identity, 96% coverage: 11:251/251 of query aligns to 3:244/244 of 7krmC
- active site: G18 (= G24), S140 (= S145), Y155 (= Y158)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), S15 (≠ A23), G18 (= G24), I19 (= I25), D38 (= D44), L39 (≠ R45), A60 (≠ V65), N61 (≠ D66), V62 (≠ L67), N88 (≠ S93), V111 (≠ I116), S140 (= S145), Y155 (= Y158), K159 (= K162), I188 (≠ V190), T190 (= T192)
1x1tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with NAD+ (see paper)
38% identity, 95% coverage: 11:249/251 of query aligns to 2:234/236 of 1x1tA
- active site: G15 (= G24), N114 (= N117), S142 (= S145), Y155 (= Y158), K159 (= K162)
- binding cacodylate ion: S142 (= S145), H144 (≠ A147), Y155 (= Y158), W187 (≠ I189), W233 (≠ Y248)
- binding nicotinamide-adenine-dinucleotide: G11 (= G20), T13 (≠ A22), S14 (≠ A23), G15 (= G24), I16 (= I25), G35 (≠ D44), F36 (vs. gap), D63 (= D66), L64 (= L67), N90 (≠ S93), G92 (= G95), L113 (≠ I116), S142 (= S145), Y155 (= Y158), K159 (= K162), P185 (= P187), W187 (≠ I189), V188 (= V190), T190 (= T192)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 97% coverage: 9:251/251 of query aligns to 3:255/255 of 5itvA
- active site: G18 (= G24), S141 (= S145), Y154 (= Y158), K158 (= K162)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G20), S17 (≠ A23), G18 (= G24), I19 (= I25), D38 (= D44), I39 (≠ R45), T61 (≠ V65), I63 (≠ L67), N89 (≠ S93), G91 (= G95), T139 (≠ L143), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P187), G185 (≠ T188), I186 (= I189), I187 (≠ V190)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
34% identity, 93% coverage: 14:247/251 of query aligns to 5:243/246 of 3osuA
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
38% identity, 95% coverage: 11:249/251 of query aligns to 2:258/260 of 2ztlA
- active site: G15 (= G24), N114 (= N117), S142 (= S145), Y155 (= Y158), K159 (= K162), L200 (≠ W199)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ V97), S142 (= S145), H144 (≠ A147), K152 (≠ H155), Y155 (= Y158), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G11 (= G20), G15 (= G24), I16 (= I25), F36 (vs. gap), L64 (= L67), N90 (≠ S93), A91 (= A94), G92 (= G95), L113 (≠ I116), Y155 (= Y158), K159 (= K162), P185 (= P187), W187 (≠ I189), V188 (= V190), T190 (= T192), V193 (≠ G195)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
38% identity, 95% coverage: 11:249/251 of query aligns to 2:258/260 of 1wmbA
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
32% identity, 96% coverage: 6:247/251 of query aligns to 1:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), S17 (≠ A22), R18 (≠ A23), I20 (= I25), T40 (≠ D44), N62 (≠ D66), V63 (≠ L67), N89 (≠ S93), A90 (= A94), I92 (≠ V96), V139 (≠ L143), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P187), G185 (≠ T188), I187 (≠ V190), T189 (= T192), M191 (≠ L194)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
35% identity, 95% coverage: 11:249/251 of query aligns to 3:244/245 of 5wuwA
- active site: G16 (= G24), S140 (= S145), Y154 (= Y158), L161 (≠ I165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), R15 (≠ A23), I17 (= I25), Y36 (vs. gap), A37 (vs. gap), A38 (vs. gap), D63 (= D66), S64 (≠ L67), N90 (≠ S93), A91 (= A94), G92 (= G95), Y154 (= Y158), K158 (= K162), G185 (≠ T188), P186 (≠ I189), V187 (= V190)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
34% identity, 98% coverage: 5:250/251 of query aligns to 3:253/254 of 3lqfA
- active site: G22 (= G24), S144 (= S145), Y159 (= Y158), K163 (= K162)
- binding meso-erythritol: N151 (≠ D153), Y159 (= Y158), Y191 (≠ I189), T197 (≠ G195), M200 (≠ V203)
- binding nicotinamide-adenine-dinucleotide: G18 (= G20), S21 (≠ A23), G22 (= G24), I23 (= I25), D42 (= D44), R43 (= R45), D66 (≠ Q72), V67 (≠ I73), S92 (= S93), L142 (= L143), S144 (= S145), K163 (= K162), P189 (= P187), V192 (= V190), T194 (= T192), M196 (≠ L194), T197 (≠ G195)
Query Sequence
>GFF2363 FitnessBrowser__WCS417:GFF2363
MSGFWNQAFDLTGHCAVITGGAAGIGLACASLLVERGARVALLDRDPAVVEVAAGLGAGH
LGIAVDLGQIGQIQHTIDTVFAHFQRLDYLINSAGVVLLDKAVDVSESAWDTTLDINLKA
SFFVAQACARHMLAQGSGRIVNLASQAAVIGLDRHVAYCASKAAIVGMTKVLAMEWAPQI
NVNAISPTIVETALGKKAWAGEVGEKAKLQIPAGRFAQPEEIAGLALYLLSDAAQMITGA
NMVIDGGYSIQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory