Comparing GFF2364 FitnessBrowser__WCS417:GFF2364 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
38% identity, 87% coverage: 1:293/335 of query aligns to 1:296/349 of A0QYB5
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
37% identity, 79% coverage: 28:293/335 of query aligns to 2:264/315 of 4rsmA
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
38% identity, 83% coverage: 17:293/335 of query aligns to 22:296/349 of A0QYB3
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
38% identity, 79% coverage: 28:293/335 of query aligns to 1:263/314 of 5hkoA
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
38% identity, 79% coverage: 28:293/335 of query aligns to 1:263/315 of 4rs3A
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
32% identity, 78% coverage: 42:301/335 of query aligns to 22:278/287 of 4yo7A
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
37% identity, 59% coverage: 62:258/335 of query aligns to 32:226/274 of 2ioyA
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
36% identity, 61% coverage: 79:283/335 of query aligns to 53:263/287 of 5dteB
Sites not aligning to the query:
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
34% identity, 71% coverage: 55:293/335 of query aligns to 25:268/284 of 7e7mC
Sites not aligning to the query:
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
29% identity, 72% coverage: 61:300/335 of query aligns to 35:289/291 of 4rxmA
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
29% identity, 72% coverage: 61:300/335 of query aligns to 33:287/288 of 4rxmB
Sites not aligning to the query:
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
32% identity, 75% coverage: 26:276/335 of query aligns to 6:259/296 of 4irxA
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
35% identity, 54% coverage: 75:255/335 of query aligns to 42:231/302 of 5ocpA
Sites not aligning to the query:
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
34% identity, 58% coverage: 61:255/335 of query aligns to 54:256/318 of P39325
Sites not aligning to the query:
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
34% identity, 58% coverage: 61:255/335 of query aligns to 32:234/296 of 2vk2A
Sites not aligning to the query:
8fxuA Thermoanaerobacter thermosaccharolyticum periplasmic glucose-binding protein glucose complex: badan conjugate attached at f17c (see paper)
32% identity, 77% coverage: 27:285/335 of query aligns to 2:276/310 of 8fxuA
5kwsA Crystal structure of galactose binding protein from yersinia pestis in the complex with beta d glucose
30% identity, 77% coverage: 30:286/335 of query aligns to 4:276/307 of 5kwsA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
28% identity, 69% coverage: 62:293/335 of query aligns to 33:271/292 of 2fn8A
Sites not aligning to the query:
P0AEE5 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Escherichia coli (strain K12) (see 4 papers)
30% identity, 84% coverage: 6:286/335 of query aligns to 7:299/332 of P0AEE5
Sites not aligning to the query:
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
29% identity, 60% coverage: 55:255/335 of query aligns to 27:234/305 of 6hbdA
Sites not aligning to the query:
>GFF2364 FitnessBrowser__WCS417:GFF2364
MKLGTTLAATAALSLLACSIAMAADGKTYKVGAAVYGLKGQFMQNWVRELKEHPAVKDGT
VQLTVFDGNYDALTQNNQIENMVTQRYDAILFVPIDTKAGVGTVKAAMSNDVVVIASNTK
VADASVPYVGNDDVEGGRLQAQAMVDKLNGKGNVVIIQGPIGQSAQIDREKGELEVLGKH
PDIKIIEKKTANWDRAQALALTEDWLNAHPKGINGVIAQNDDMALGAVQALKSHGLTSKD
VPVTSIDGMPDAIQAAKKDEVTTFLQDAQAQSQGALDVALRALAGKDYKPQSVIWERYAK
EVKWGDGTAKNYILPWVPVTNANADALYKQVSGGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory