Comparing GFF2372 FitnessBrowser__WCS417:GFF2372 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
34% identity, 82% coverage: 38:267/282 of query aligns to 3:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
33% identity, 82% coverage: 38:267/282 of query aligns to 3:226/226 of 4zv1A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
34% identity, 84% coverage: 30:266/282 of query aligns to 1:228/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
30% identity, 83% coverage: 32:266/282 of query aligns to 3:227/229 of 6svfA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
30% identity, 73% coverage: 61:266/282 of query aligns to 36:234/243 of 5eyfB
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
30% identity, 74% coverage: 35:243/282 of query aligns to 7:211/247 of 2yjpA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
27% identity, 85% coverage: 30:270/282 of query aligns to 5:242/251 of 1xt8B
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
25% identity, 83% coverage: 31:265/282 of query aligns to 2:229/231 of 2v25A
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
27% identity, 82% coverage: 40:269/282 of query aligns to 4:224/226 of 8eyzA
5kkwA Crystal structure of sar11_1068 bound to a sulfobetaine (3-(1- methylpiperidinium-1-yl)propane-1-sulfonate)
31% identity, 76% coverage: 29:243/282 of query aligns to 1:212/237 of 5kkwA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
27% identity, 80% coverage: 41:266/282 of query aligns to 8:227/228 of 2y7iA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
26% identity, 89% coverage: 28:278/282 of query aligns to 40:283/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
26% identity, 89% coverage: 28:278/282 of query aligns to 40:283/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
26% identity, 89% coverage: 28:278/282 of query aligns to 41:284/288 of 6h2tA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
27% identity, 81% coverage: 38:266/282 of query aligns to 3:226/234 of 3k4uE
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
28% identity, 81% coverage: 43:270/282 of query aligns to 8:235/238 of 1hslA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
28% identity, 81% coverage: 43:270/282 of query aligns to 30:257/260 of P02910
Sites not aligning to the query:
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
26% identity, 82% coverage: 40:270/282 of query aligns to 27:257/260 of P0AEU0
Sites not aligning to the query:
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
32% identity, 61% coverage: 30:201/282 of query aligns to 2:171/240 of 4h5fA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
26% identity, 81% coverage: 39:266/282 of query aligns to 1:222/224 of 4ymxA
>GFF2372 FitnessBrowser__WCS417:GFF2372
MHHRPSVFKACVFLFAASASLASIVQAADSKLDDVLKRGHLIVGTGSTNAPWHFQGADGK
LQGFDIDIGRIVAKGLFNDPSKVEFVVQSSDARIPNLLTDKVDMSCQFITVTASRAQQVA
FTLPYYREGVGLLLPNNSKYKEIEDLQAAGDGVTVAVLQNVYAEELVHQALPKAKVDQYD
SVDLMYQAVNSGRADAAATDQSSVKYLMVQNPGRYRSPAYAWSPQTYACAVKRGDQDWLN
FVNTALHEAMTGVEFPTYKASFKQWFGVDLPEPAIGFPVEFK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory