Comparing GFF2375 FitnessBrowser__WCS417:GFF2375 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
51% identity, 96% coverage: 10:258/260 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
51% identity, 96% coverage: 10:258/260 of query aligns to 3:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
51% identity, 96% coverage: 10:258/260 of query aligns to 3:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
51% identity, 96% coverage: 10:258/260 of query aligns to 3:241/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
53% identity, 96% coverage: 10:258/260 of query aligns to 1:239/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
50% identity, 96% coverage: 9:258/260 of query aligns to 1:239/241 of 4u00A
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
49% identity, 95% coverage: 11:256/260 of query aligns to 7:254/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
49% identity, 95% coverage: 11:256/260 of query aligns to 3:250/258 of 1b0uA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 98% coverage: 3:258/260 of query aligns to 10:251/378 of P69874
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 90% coverage: 23:257/260 of query aligns to 18:243/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 90% coverage: 23:257/260 of query aligns to 19:244/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 90% coverage: 23:257/260 of query aligns to 19:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 90% coverage: 23:257/260 of query aligns to 19:244/344 of 3tuiC
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
35% identity, 92% coverage: 18:257/260 of query aligns to 34:265/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
35% identity, 92% coverage: 18:257/260 of query aligns to 34:265/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
36% identity, 88% coverage: 18:246/260 of query aligns to 34:254/260 of 7ahdC
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
39% identity, 82% coverage: 14:227/260 of query aligns to 11:215/226 of 5xu1B
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
36% identity, 95% coverage: 10:255/260 of query aligns to 9:243/375 of 2d62A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
38% identity, 85% coverage: 12:233/260 of query aligns to 8:216/223 of 2pclA
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
37% identity, 87% coverage: 10:236/260 of query aligns to 1:226/232 of 1f3oA
>GFF2375 FitnessBrowser__WCS417:GFF2375
MNQPHTNQPLLNIRGLRKQYGQVEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNLLE
EFQGGQITLDGESIGYSEIAGKRVRHPERVIAQHRAMTGMAFQQFNLFPHLTALQNVTLG
LLKVKKMPKDEAVALAEKWLDRVGLLERRNHFPGQLSGGQQQRVAIARAIAMNPSLMLFD
EVTSALDPELVGEVLSVIKGLAEEGMTMLLVTHEMRFAYEVSDKIVFMNQGRIEEQGTSK
DIFERPQSPRLAEFLKNIRF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory