Comparing GFF2378 FitnessBrowser__WCS417:GFF2378 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
A1B8Z1 3-hydroxy-D-aspartate aldolase; beta-hydroxyaspartate aldolase; EC 4.1.3.41 from Paracoccus denitrificans (strain Pd 1222) (see paper)
28% identity, 91% coverage: 21:385/402 of query aligns to 26:368/387 of A1B8Z1
6qkbA Crystal structure of the beta-hydroxyaspartate aldolase of paracoccus denitrificans (see paper)
28% identity, 91% coverage: 21:385/402 of query aligns to 23:365/384 of 6qkbA
4v15A Crystal structure of d-threonine aldolase from alcaligenes xylosoxidans (see paper)
26% identity, 92% coverage: 11:380/402 of query aligns to 8:347/373 of 4v15A
7yqaB Crystal structure of d-threonine aldolase from chlamydomonas reinhardtii (see paper)
28% identity, 92% coverage: 16:384/402 of query aligns to 12:367/398 of 7yqaB
>GFF2378 FitnessBrowser__WCS417:GFF2378
MSAINAVEKGAAAVGAHLVRDVSLPALVLHRDALEHNIRWMQDFVSNSGAELAPHGKTSM
MPALFQRQIEAGAWGITLANAVQTRAAYAGGVRRVLMANQLVGAPNMALIADLLADKDFD
FHCMVDHPDNVADLGLFFAARGLRLNVMIEYGVVGGRCGCRTEQEVRDLARAIKAQPALA
LTGIEGYEGVIHGEHAISGIRDFAASLVRLAVDLQNNGSFDLPKPIVTASGSAWYDLIAE
SFEQQNAAGRFLSVLRPGSYVAHDHGIYKEAQCCVLDRRSDLNEGLRPALEVWAHVQSLP
EPGFAVIALGKRDVAYDAGLPVPLKRYKAGILPAEGDDVTACKVTAVMDQHAFMTVAPGV
ELRIGDIISFGTSHPCLTFDKWQVGCLVDEQLQVIESLETRF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory