Comparing GFF2379 PS417_12130 ketodeoxygluconokinase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
42% identity, 95% coverage: 7:300/309 of query aligns to 16:304/306 of 4ebuA
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
41% identity, 93% coverage: 7:294/309 of query aligns to 16:294/294 of 4eumA
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
33% identity, 87% coverage: 12:280/309 of query aligns to 8:269/300 of 1v1bA
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
33% identity, 87% coverage: 12:280/309 of query aligns to 8:269/301 of 1v1aA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
33% identity, 87% coverage: 12:280/309 of query aligns to 8:269/309 of Q53W83
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 90% coverage: 7:284/309 of query aligns to 6:274/319 of Q8ZKR2
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
27% identity, 90% coverage: 7:284/309 of query aligns to 2:263/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
27% identity, 90% coverage: 7:284/309 of query aligns to 2:263/297 of 1tz6A
Sites not aligning to the query:
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
24% identity, 89% coverage: 7:281/309 of query aligns to 2:274/308 of 2dcnA
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
26% identity, 74% coverage: 54:281/309 of query aligns to 55:274/308 of 3iq0B
Sites not aligning to the query:
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
23% identity, 93% coverage: 11:297/309 of query aligns to 7:293/313 of Q97U29
Sites not aligning to the query:
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
23% identity, 93% coverage: 11:297/309 of query aligns to 6:292/311 of 2varA
Sites not aligning to the query:
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
24% identity, 85% coverage: 7:269/309 of query aligns to 3:256/306 of 5eynA
Sites not aligning to the query:
Q57849 Nucleoside kinase; NK; ATP-dependent nucleoside monophosphokinase; Cytidine kinase; Guanosine-inosine kinase; EC 2.7.1.213; EC 2.7.1.73 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
32% identity, 25% coverage: 223:298/309 of query aligns to 208:283/302 of Q57849
Sites not aligning to the query:
2c49A Crystal structure of methanocaldococcus jannaschii nucleoside kinase - an archaeal member of the ribokinase family (see paper)
32% identity, 25% coverage: 223:298/309 of query aligns to 206:281/299 of 2c49A
Sites not aligning to the query:
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
22% identity, 88% coverage: 26:298/309 of query aligns to 34:294/312 of 3in1A
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
27% identity, 79% coverage: 31:274/309 of query aligns to 38:264/306 of 4xckA
Sites not aligning to the query:
6a8cA Ribokinase from leishmania donovani with adp (see paper)
26% identity, 87% coverage: 5:272/309 of query aligns to 13:288/327 of 6a8cA
Sites not aligning to the query:
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
26% identity, 87% coverage: 5:272/309 of query aligns to 13:288/327 of 6a8bA
Sites not aligning to the query:
6a8aA Ribokinase from leishmania donovani with atp (see paper)
26% identity, 87% coverage: 5:272/309 of query aligns to 13:288/327 of 6a8aA
Sites not aligning to the query:
>GFF2379 PS417_12130 ketodeoxygluconokinase
MTRLSPRIALIGECMIELQHRADGSLHQSFGGDTLNTAVYLRRELGETGSVDYVTALGDD
SFSDAMCKQWKDEGLGLGRVQRLPGRLPGLYCIQTDANGERKFLYWRNEAAVRDCFTTPA
AEPILAALPDYDVVYFSGITLAVLGDIGRERLLQTLVETRRRGGKVVFDNNYRPRLWAGI
EAARTAYHRVLAEVDIALLTEDDERALFGYADSEQVFAAYPGIDEVVLKRGADDCLIRWA
GERFAVPAVKVEKVVDTTAAGDSFSAAYLASRLKGSSPEQAALAGHRLASRVIQVPGALI
PRVYTKPVW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory