Comparing GFF2386 FitnessBrowser__WCS417:GFF2386 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
36% identity, 49% coverage: 1:255/523 of query aligns to 1:264/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
37% identity, 44% coverage: 22:252/523 of query aligns to 27:257/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
37% identity, 44% coverage: 22:252/523 of query aligns to 26:256/310 of 4fwiB
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
33% identity, 48% coverage: 3:252/523 of query aligns to 3:246/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
33% identity, 48% coverage: 3:252/523 of query aligns to 3:246/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
33% identity, 48% coverage: 3:252/523 of query aligns to 3:246/250 of 7z16I
3c4jA Abc protein artp in complex with atp-gamma-s
34% identity, 48% coverage: 1:250/523 of query aligns to 1:238/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
34% identity, 48% coverage: 1:250/523 of query aligns to 1:238/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
34% identity, 48% coverage: 1:250/523 of query aligns to 1:238/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
34% identity, 48% coverage: 1:250/523 of query aligns to 1:238/242 of 2oljA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 48% coverage: 3:252/523 of query aligns to 1:243/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 48% coverage: 2:252/523 of query aligns to 1:244/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 48% coverage: 2:252/523 of query aligns to 1:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 48% coverage: 2:252/523 of query aligns to 1:244/344 of 3tuiC
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 43% coverage: 290:516/523 of query aligns to 15:236/241 of 4u00A
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 45% coverage: 283:517/523 of query aligns to 7:237/240 of 4ymuJ
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 41% coverage: 296:511/523 of query aligns to 36:243/378 of P69874
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 42% coverage: 286:507/523 of query aligns to 14:232/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 42% coverage: 286:507/523 of query aligns to 14:232/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 42% coverage: 286:507/523 of query aligns to 14:232/353 of 1oxuA
Sites not aligning to the query:
>GFF2386 FitnessBrowser__WCS417:GFF2386
MNLIEIRDLSVAFSGQTVVRNLSLDVRPGECLALVGESGSGKSVTAHSILQLLPEAGTET
TGSIQYRGQELIGASAATLQKLRGNRIAMIFQEPMTSLNPLHSIEKQIGETLLLHKGLGG
KAAQARILELLDLVGIQKPQERLKAYPHQLSGGQRQRVMIAMALACEPELLIADEPTTAL
DVTVQRKILLLLKSLQKRLGMSLLLISHDLNLVRSIAQRVCVMRAGEIVEQADCQTLFNA
PQHPYSRLLLDAEPDADALCSDERETVLQVDDLTVQFRLGGGLFRRKTYLRAVDGISLSV
QRGKTLGIVGESGSGKSTLGQAILRLLDSTGSIRFQGEALDPLNNQQMRPWRKQMQVVFQ
DPYGSLSPRMTVEQIISEGLEVHAPCSLADRDAQVIQVLKDVGLDPASRHRYPHEFSGGQ
RQRIAIARALVLKPALMLLDEPTSALDRTVQKQVVALLRELQDKYGLTYLFISHDLAVVR
AMAHDMIVIKDGQVVERGASHAVFDAPQHPYTKELLAAAHIPL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory