SitesBLAST
Comparing GFF2388 FitnessBrowser__psRCH2:GFF2388 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zz7A Crystal structure of methylmalonate-semialdehyde dehydrogenase (dddc) from oceanimonas doudoroffii (see paper)
48% identity, 95% coverage: 9:486/503 of query aligns to 3:481/489 of 4zz7A
- active site: N149 (= N156), K172 (= K179), L246 (≠ M253), C280 (= C287), E382 (= E387), A462 (≠ P467)
- binding nicotinamide-adenine-dinucleotide: T146 (= T153), P147 (= P154), F148 (= F155), N149 (= N156), K172 (= K179), E175 (= E182), K205 (≠ P212), V208 (= V215), F222 (= F229), V223 (= V230), G224 (= G231), S225 (= S232), I228 (≠ V235), L246 (≠ M253), G247 (≠ M254), C280 (= C287), E382 (= E387), F384 (= F389)
4iymC Crystal structure of putative methylmalonate-semialdehyde dehydrogenase from sinorhizobium meliloti 1021 complexed with NAD, target 011934
49% identity, 94% coverage: 13:486/503 of query aligns to 10:485/491 of 4iymC
- active site: N153 (= N156), K176 (= K179), F250 (≠ M253), C284 (= C287), E386 (= E387), Q466 (≠ P467)
- binding nicotinamide-adenine-dinucleotide: I149 (= I152), T150 (= T153), P151 (= P154), F152 (= F155), N153 (= N156), F154 (= F157), K176 (= K179), K209 (≠ P212), V212 (= V215), F226 (= F229), V227 (= V230), G228 (= G231), S229 (= S232), I232 (≠ V235), G251 (≠ M254), C284 (= C287), E386 (= E387), F388 (= F389)
1t90A Crystal structure of methylmalonate semialdehyde dehydrogenase from bacillus subtilis
48% identity, 95% coverage: 7:486/503 of query aligns to 2:479/484 of 1t90A
- active site: N151 (= N156), K174 (= K179), L248 (≠ M253), C282 (= C287), E380 (= E387), A460 (≠ P467)
- binding nicotinamide-adenine-dinucleotide: I147 (= I152), A148 (≠ T153), P149 (= P154), F150 (= F155), N151 (= N156), W159 (= W164), K174 (= K179), E177 (= E182), R178 (≠ Q183), H207 (≠ P212), V225 (= V230), G226 (= G231), S227 (= S232), V230 (= V235), L248 (≠ M253), T249 (≠ M254), C282 (= C287), E380 (= E387), F382 (= F389)
P42412 Malonate-semialdehyde dehydrogenase; MSA dehydrogenase; Methylmalonate-semialdehyde dehydrogenase; MMSA dehydrogenase; MMSDH; MSDH; EC 1.2.1.27 from Bacillus subtilis (strain 168) (see 3 papers)
48% identity, 96% coverage: 5:486/503 of query aligns to 2:481/487 of P42412
- C36 (≠ A39) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-160; A-287; A-351 and A-413.
- R107 (= R110) mutation to L: At least 50-fold decrease of the second-order rate constant for the acylation step.
- A150 (≠ T153) binding
- F152 (= F155) binding
- C160 (≠ L163) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-287; A-351 and A-413.
- K176 (= K179) binding
- E179 (= E182) binding
- R180 (≠ Q183) binding
- S229 (= S232) binding
- T251 (≠ M254) binding
- R283 (= R286) mutation to L: At least 50-fold decrease of the second-order rate constant for the acylation step.
- C287 (≠ L290) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-351 and A-413.
- C351 (≠ L353) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-287 and A-413.
- E382 (= E387) binding
- C413 (≠ A418) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-287 and A-351.
5tjrD X-ray crystal structure of a methylmalonate semialdehyde dehydrogenase from pseudomonas sp. Aac (see paper)
47% identity, 95% coverage: 10:486/503 of query aligns to 3:455/468 of 5tjrD
- active site: N144 (= N156), K167 (= K179), L241 (≠ M253), C270 (= C287), E356 (= E387), A436 (≠ P467)
- binding adenosine-5'-diphosphate: I140 (= I152), T141 (= T153), F143 (= F155), K167 (= K179), E170 (= E182), K200 (≠ P212), F217 (= F229), S220 (= S232), I223 (≠ V235)
5gtlA NADPH complex structure of aldehyde dehydrogenase from bacillus cereus
34% identity, 94% coverage: 10:482/503 of query aligns to 17:486/491 of 5gtlA
- active site: N165 (= N156), K188 (= K179), E263 (≠ M253), C297 (= C287), E394 (= E387), E471 (≠ D464)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I161 (= I152), P163 (= P154), K188 (= K179), A190 (≠ S181), E191 (= E182), Q192 (= Q183), G221 (= G211), G225 (≠ V215), G241 (= G231), S242 (= S232), T245 (≠ V235), L264 (≠ M254), C297 (= C287), E394 (= E387), F396 (= F389)
5gtkA NAD+ complex structure of aldehyde dehydrogenase from bacillus cereus
34% identity, 94% coverage: 10:482/503 of query aligns to 17:486/491 of 5gtkA
- active site: N165 (= N156), K188 (= K179), E263 (≠ M253), C297 (= C287), E394 (= E387), E471 (≠ D464)
- binding nicotinamide-adenine-dinucleotide: I161 (= I152), I162 (≠ T153), P163 (= P154), W164 (≠ F155), K188 (= K179), E191 (= E182), G221 (= G211), G225 (≠ V215), A226 (≠ N216), F239 (= F229), G241 (= G231), S242 (= S232), T245 (≠ V235), Y248 (≠ H238), L264 (≠ M254), C297 (= C287), Q344 (≠ A333), R347 (= R336), E394 (= E387), F396 (= F389)
6wsbA Crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei bound to cofactor NAD (see paper)
34% identity, 94% coverage: 11:482/503 of query aligns to 7:477/489 of 6wsbA
- active site: N152 (= N156), E250 (≠ M253), C284 (= C287), E462 (≠ P467)
- binding nicotinamide-adenine-dinucleotide: I148 (= I152), G149 (≠ T153), A150 (≠ P154), W151 (≠ F155), N152 (= N156), K175 (= K179), E178 (= E182), G208 (≠ P212), G211 (≠ V215), A212 (≠ N216), F225 (= F229), T226 (≠ V230), G227 (= G231), G228 (≠ S232), T231 (≠ V235), V235 (= V239), E250 (≠ M253), L251 (≠ M254), G252 (= G255), C284 (= C287), E385 (= E387), F387 (= F389)
O14293 Putative aldehyde dehydrogenase-like protein C9E9.09c; EC 1.2.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 96% coverage: 2:482/503 of query aligns to 15:493/503 of O14293
- S248 (= S232) modified: Phosphoserine
Sites not aligning to the query:
- 501 modified: Phosphoserine
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
33% identity, 91% coverage: 11:470/503 of query aligns to 7:474/489 of 4cazA
- active site: N152 (= N156), K175 (= K179), E251 (≠ M253), C285 (= C287), E386 (= E387), E463 (≠ A459)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (= I152), G149 (≠ T153), W151 (≠ F155), N152 (= N156), K175 (= K179), E178 (= E182), G208 (= G211), G212 (≠ V215), F226 (= F229), T227 (≠ V230), G228 (= G231), G229 (≠ S232), T232 (≠ V235), V236 (= V239), E251 (≠ M253), L252 (≠ M254), C285 (= C287), E386 (= E387), F388 (= F389)
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
33% identity, 91% coverage: 11:470/503 of query aligns to 7:474/489 of 2woxA
- active site: N152 (= N156), K175 (= K179), E251 (≠ M253), C285 (= C287), E386 (= E387), E463 (≠ A459)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (= I152), G149 (≠ T153), W151 (≠ F155), N152 (= N156), K175 (= K179), S177 (= S181), E178 (= E182), G208 (= G211), G212 (≠ V215), F226 (= F229), T227 (≠ V230), G228 (= G231), G229 (≠ S232), T232 (≠ V235), V236 (= V239), E251 (≠ M253), L252 (≠ M254), C285 (= C287), E386 (= E387), F388 (= F389)
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
33% identity, 91% coverage: 11:470/503 of query aligns to 7:474/489 of 2wmeA
- active site: N152 (= N156), K175 (= K179), E251 (≠ M253), C285 (= C287), E386 (= E387), E463 (≠ A459)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (≠ T153), W151 (≠ F155), K175 (= K179), S177 (= S181), E178 (= E182), G208 (= G211), G212 (≠ V215), F226 (= F229), G228 (= G231), G229 (≠ S232), T232 (≠ V235), V236 (= V239)
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
33% identity, 91% coverage: 11:470/503 of query aligns to 8:475/490 of Q9HTJ1
- GAWN 150:153 (≠ TPFN 153:156) binding
- K162 (≠ M165) active site, Charge relay system
- KPSE 176:179 (= KPSE 179:182) binding
- G209 (= G211) binding
- GTST 230:233 (≠ STKV 232:235) binding
- E252 (≠ M253) active site, Proton acceptor
- C286 (= C287) binding covalent; modified: Cysteine sulfenic acid (-SOH)
- E387 (= E387) binding
- E464 (≠ A459) active site, Charge relay system
1bpwA Betaine aldehyde dehydrogenase from cod liver (see paper)
32% identity, 90% coverage: 29:482/503 of query aligns to 40:492/503 of 1bpwA
- active site: N166 (= N156), K189 (= K179), E263 (≠ M253), C297 (= C287), E400 (= E387), E477 (≠ L465)
- binding nicotinamide-adenine-dinucleotide: I162 (= I152), L163 (≠ T153), W165 (≠ F155), N166 (= N156), K189 (= K179), G221 (= G211), G225 (≠ V215), T240 (≠ V230), G241 (= G231), S242 (= S232), T245 (≠ V235), E263 (≠ M253), L264 (≠ M254), C297 (= C287), E400 (= E387), F402 (= F389), F466 (= F454)
P56533 4-trimethylaminobutyraldehyde dehydrogenase; TMABA-DH; TMABADH; Aldehyde dehydrogenase family 9 member A1; Betaine aldehyde dehydrogenase; BADH; EC 1.2.1.47; EC 1.2.1.3 from Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias) (see paper)
32% identity, 90% coverage: 29:482/503 of query aligns to 40:492/503 of P56533
7jwwA Crystal structure of human aldh1a1 bound to compound (r)-28 (see paper)
33% identity, 97% coverage: 1:490/503 of query aligns to 5:493/494 of 7jwwA
- active site: N163 (= N156), K186 (= K179), E262 (≠ M253), C296 (= C287), E393 (= E387), E470 (≠ D464)
- binding 5-{4-[(Z)-2-hydroxyethenyl]phenyl}-1-methyl-6-{[(1R)-1-phenylethyl]sulfanyl}-1,5-dihydro-4H-pyrazolo[3,4-d]pyrimidin-4-one: G118 (≠ R110), T122 (≠ V114), F164 (= F157), M168 (≠ I161), Y290 (≠ G281), C295 (≠ R286), C296 (= C287), I297 (≠ M288), V453 (= V443), F459 (≠ V449)
7jwvA Crystal structure of human aldh1a1 bound to compound (r)-28 (see paper)
33% identity, 97% coverage: 1:490/503 of query aligns to 5:493/494 of 7jwvA
- active site: N163 (= N156), K186 (= K179), E262 (≠ M253), C296 (= C287), E393 (= E387), E470 (≠ D464)
- binding 5-[4-(hydroxymethyl)phenyl]-1-methyl-6-{[(1R)-1-phenylethyl]sulfanyl}-1,5-dihydro-4H-pyrazolo[3,4-d]pyrimidin-4-one: G118 (≠ R110), T122 (≠ V114), F164 (= F157), M168 (≠ I161), Y290 (≠ G281), C295 (≠ R286), I297 (≠ M288), V453 (= V443), F459 (≠ V449)
7jwuA Crystal structure of human aldh1a1 bound to compound (r)-28 (see paper)
33% identity, 97% coverage: 1:490/503 of query aligns to 5:493/494 of 7jwuA
- active site: N163 (= N156), K186 (= K179), E262 (≠ M253), C296 (= C287), E393 (= E387), E470 (≠ D464)
- binding nicotinamide-adenine-dinucleotide: I159 (= I152), I160 (≠ T153), P161 (= P154), W162 (≠ F155), N163 (= N156), K186 (= K179), E189 (= E182), G219 (= G211), G223 (≠ V215), A224 (≠ N216), F237 (= F229), T238 (≠ V230), G239 (= G231), S240 (= S232), V243 (= V235), L263 (≠ M254), C296 (= C287), Q343 (≠ A333), K346 (≠ R336), E393 (= E387), F395 (= F389)
- binding 1-methyl-5-phenyl-6-{[(1R)-1-(pyridin-2-yl)ethyl]sulfanyl}-1,5-dihydro-4H-pyrazolo[3,4-d]pyrimidin-4-one: T122 (≠ V114), F164 (= F157), W171 (= W164), Y290 (≠ G281), C295 (≠ R286), I297 (≠ M288), V453 (= V443), F459 (≠ V449)
7jwtA Crystal structure of human aldh1a1 bound to compound (r)-28 (see paper)
33% identity, 97% coverage: 1:490/503 of query aligns to 5:493/494 of 7jwtA
- active site: N163 (= N156), K186 (= K179), E262 (≠ M253), C296 (= C287), E393 (= E387), E470 (≠ D464)
- binding 6-{[(1R)-1-(3-hydroxyphenyl)ethyl]sulfanyl}-1-methyl-5-phenyl-1,5-dihydro-4H-pyrazolo[3,4-d]pyrimidin-4-one: G118 (≠ R110), T122 (≠ V114), F164 (= F157), M168 (≠ I161), W171 (= W164), Y290 (≠ G281), C295 (≠ R286), V453 (= V443), F459 (≠ V449)
7jwsA Crystal structure of human aldh1a1 bound to compound (r)-28 (see paper)
33% identity, 97% coverage: 1:490/503 of query aligns to 5:493/494 of 7jwsA
- active site: N163 (= N156), K186 (= K179), E262 (≠ M253), C296 (= C287), E393 (= E387), E470 (≠ D464)
- binding 1-methyl-5-phenyl-6-{[(1R)-1-phenylethyl]sulfanyl}-1,5-dihydro-4H-pyrazolo[3,4-d]pyrimidin-4-one: G118 (≠ R110), T122 (≠ V114), F164 (= F157), M168 (≠ I161), W171 (= W164), Y290 (≠ G281), C295 (≠ R286), I297 (≠ M288), V453 (= V443), F459 (≠ V449)
Query Sequence
>GFF2388 FitnessBrowser__psRCH2:GFF2388
MTTSSSIPTVKLLIDGEFIESTTQDWRDVVNPATQEVLARVPFATAEEIDRAVASGQKAF
KTWRKTPIGARARIFLKYQQLIRENMKELAAILTAEQGKTLADAEGDVFRGLEVVEHAAG
IGNLQLGELANNVAAGVDTYTLLQPLGVCAGITPFNFPAMIPLWMFPMAIATGNTFVLKP
SEQDPMVTMRLCELALEAGVPPGVLNVVHGGPDVVNAICDHPDIKAVSFVGSTKVGTHVY
NRASQAGKRVQCMMGAKNHAIVLPDAHKEQTLNNLAGAAFGAAGQRCMALSVVVLVGEAQ
AWIPDLVAKAQTLKVNAGVEAGTDVGPLVSCAALDRVSGLIERGVREGAKLELDGRNPSV
SGYENGNFVGPTIFSGVTREMSVYQEEIFGPVLCVMAAATMDEAIELINANPNGNGTAIF
TRSGAAARHFQEEIDVGQVGINVPIPVPVPMFSFTGSRASKLGDLGPYGKQVVQFYTQTK
TITERWFDENEVGGPVNTTINLK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory